O00755 · WNT7A_HUMAN
- ProteinProtein Wnt-7a
- GeneWNT7A
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids349 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway (By similarity).
Plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development and urogenital tract development (PubMed:16826533).
Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (PubMed:30026314).
Required for normal, sexually dimorphic development of the Mullerian ducts, and for normal fertility in both sexes (By similarity).
Required for normal neural stem cell proliferation in the hippocampus dentate gyrus (By similarity).
Required for normal progress through the cell cycle in neural progenitor cells, for self-renewal of neural stem cells, and for normal neuronal differentiation and maturation (By similarity).
Promotes formation of synapses via its interaction with FZD5 (By similarity).
Plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development and urogenital tract development (PubMed:16826533).
Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (PubMed:30026314).
Required for normal, sexually dimorphic development of the Mullerian ducts, and for normal fertility in both sexes (By similarity).
Required for normal neural stem cell proliferation in the hippocampus dentate gyrus (By similarity).
Required for normal progress through the cell cycle in neural progenitor cells, for self-renewal of neural stem cells, and for normal neuronal differentiation and maturation (By similarity).
Promotes formation of synapses via its interaction with FZD5 (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein Wnt-7a
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO00755
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Limb pelvis hypoplasia aplasia syndrome (LPHAS)
- Note
- DescriptionA syndrome of severe deficiency of the extremities due to hypo- or aplasia of one or more long bones of one or more limbs. Pelvic manifestations include hip dislocation, hypoplastic iliac bone and aplastic pubic bones. Thoracic deformity, unusual facies and genitourinary anomalies can be present.
- See alsoMIM:276820
Natural variants in LPHAS
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_065765 | 72 | E>K | in LPHAS; dbSNP:rs397514666 | |
VAR_077340 | 102 | R>W | in LPHAS; uncertain significance; dbSNP:rs879255548 | |
VAR_064480 | 222 | R>W | in LPHAS; dbSNP:rs397514643 | |
VAR_030674 | 292 | R>C | in LPHAS; results in a loss of function mutation with some residual activity; dbSNP:rs104893835 |
Fuhrmann syndrome (FUHRS)
- Note
- DescriptionDistinct limb-malformation disorder characterized also by various degrees of limb aplasia/hypoplasia and joint dysplasia.
- See alsoMIM:228930
Natural variants in FUHRS
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_030673 | 109 | A>T | in FUHRS; retains activity that is significant but not comparable to wild-type activity; dbSNP:rs104893832 |
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_065765 | 72 | in LPHAS; dbSNP:rs397514666 | |||
Sequence: E → K | ||||||
Natural variant | VAR_077340 | 102 | in LPHAS; uncertain significance; dbSNP:rs879255548 | |||
Sequence: R → W | ||||||
Natural variant | VAR_030673 | 109 | in FUHRS; retains activity that is significant but not comparable to wild-type activity; dbSNP:rs104893832 | |||
Sequence: A → T | ||||||
Mutagenesis | 206 | Does not affect interaction with RECK. | ||||
Sequence: S → A | ||||||
Natural variant | VAR_064480 | 222 | in LPHAS; dbSNP:rs397514643 | |||
Sequence: R → W | ||||||
Mutagenesis | 241 | In 4A; abolished interaction with RECK; when associated with 251-A-A-252 and A-262. | ||||
Sequence: V → A | ||||||
Mutagenesis | 251-252 | In 4A; abolished interaction with RECK; when associated with A-241 and A-262. | ||||
Sequence: FL → AA | ||||||
Mutagenesis | 262 | In 4A; abolished interaction with RECK; when associated with A-241 and 251-A-A-252. | ||||
Sequence: K → A | ||||||
Natural variant | VAR_030674 | 292 | in LPHAS; results in a loss of function mutation with some residual activity; dbSNP:rs104893835 | |||
Sequence: R → C |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 409 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-31 | |||||
Sequence: MNRKARRCLGHLFLSLGMVYLRIGGFSSVVA | ||||||
Chain | PRO_0000041442 | 32-349 | Protein Wnt-7a | |||
Sequence: LGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK | ||||||
Disulfide bond | 73↔84 | |||||
Sequence: CQFQFRNGRWNC | ||||||
Glycosylation | 83 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 123↔131 | |||||
Sequence: CTQGNLSDC | ||||||
Glycosylation | 127 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 133↔152 | |||||
Sequence: CDKEKQGQYHRDEGWKWGGC | ||||||
Disulfide bond | 200↔214 | |||||
Sequence: CKCHGVSGSCTTKTC | ||||||
Disulfide bond | 202↔209 | |||||
Sequence: CHGVSGSC | ||||||
Lipidation | 206 | O-palmitoleoyl serine; by PORCN | ||||
Sequence: S | ||||||
Disulfide bond | 278↔309 | |||||
Sequence: CEEDPVTGSVGTQGRACNKTAPQASGCDLMCC | ||||||
Disulfide bond | 294↔304 | |||||
Sequence: CNKTAPQASGC | ||||||
Glycosylation | 295 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 308↔348 | |||||
Sequence: CCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTC | ||||||
Disulfide bond | 324↔339 | |||||
Sequence: CNCKFHWCCYVKCNTC | ||||||
Disulfide bond | 326↔336 | |||||
Sequence: CKFHWCCYVKC | ||||||
Disulfide bond | 331↔332 | |||||
Sequence: CC |
Post-translational modification
Palmitoleoylation is required for efficient binding to frizzled receptors. Depalmitoleoylation leads to Wnt signaling pathway inhibition.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Forms a soluble 1:1 complex with AFM; this prevents oligomerization and is required for prolonged biological activity (PubMed:26902720).
The complex with AFM may represent the physiological form in body fluids (PubMed:26902720).
Interacts with PORCN (By similarity).
Interacts (via intrinsically disordered linker region) with RECK; interaction with RECK confers ligand selectivity for Wnt7 in brain endothelial cells and allows these cells to selectively respond to Wnt7 (PubMed:30026314).
Interacts with FZD5 (PubMed:26908622).
The complex with AFM may represent the physiological form in body fluids (PubMed:26902720).
Interacts with PORCN (By similarity).
Interacts (via intrinsically disordered linker region) with RECK; interaction with RECK confers ligand selectivity for Wnt7 in brain endothelial cells and allows these cells to selectively respond to Wnt7 (PubMed:30026314).
Interacts with FZD5 (PubMed:26908622).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O00755 | CASP6 P55212 | 3 | EBI-727198, EBI-718729 | |
BINARY | O00755 | FGFR3 P22607 | 3 | EBI-727198, EBI-348399 | |
BINARY | O00755 | GSN P06396 | 3 | EBI-727198, EBI-351506 | |
BINARY | O00755 | LAMP2 P13473-2 | 3 | EBI-727198, EBI-21591415 | |
XENO | O00755 | Reck Q9Z0J1 | 4 | EBI-727198, EBI-20720091 | |
BINARY | O00755 | UBQLN1 Q9UMX0 | 3 | EBI-727198, EBI-741480 | |
BINARY | O00755 | WIF1 Q9Y5W5 | 3 | EBI-727198, EBI-3922719 | |
BINARY | O00755 | WLS Q5T9L3 | 3 | EBI-727198, EBI-2868748 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 238-266 | Disordered linker | ||||
Sequence: VEPVRASRNKRPTFLKIKKPLSYRKPMDT |
Domain
The intrinsically disordered linker region is required for recognition by RECK in brain endothelial cells.
Sequence similarities
Belongs to the Wnt family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length349
- Mass (Da)39,005
- Last updated2007-04-17 v2
- Checksum259EF506CFCD7AB0
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 6 | in Ref. 1; AAC51319 | ||||
Sequence: R → L | ||||||
Sequence conflict | 14 | in Ref. 2; BAA82509 | ||||
Sequence: L → F | ||||||
Sequence conflict | 20 | in Ref. 1; AAC51319 | ||||
Sequence: Y → C | ||||||
Sequence conflict | 35 | in Ref. 1; AAC51319 | ||||
Sequence: S → T | ||||||
Sequence conflict | 103-104 | in Ref. 1; AAC51319 | ||||
Sequence: EA → DG | ||||||
Sequence conflict | 125 | in Ref. 1; AAC51319 | ||||
Sequence: Q → H | ||||||
Sequence conflict | 280 | in Ref. 5; no nucleotide entry | ||||
Sequence: E → G | ||||||
Sequence conflict | 329 | in Ref. 2; BAA82509 | ||||
Sequence: H → Q | ||||||
Sequence conflict | 338 | in Ref. 2; BAA82509 | ||||
Sequence: T → K |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U53476 EMBL· GenBank· DDBJ | AAC51319.1 EMBL· GenBank· DDBJ | mRNA | ||
D83175 EMBL· GenBank· DDBJ | BAA82509.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471055 EMBL· GenBank· DDBJ | EAW64173.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC008811 EMBL· GenBank· DDBJ | AAH08811.1 EMBL· GenBank· DDBJ | mRNA |