M9PBE2 · HAKAI_DROME
- ProteinE3 ubiquitin-protein ligase Hakai
- GeneHakai
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids473 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
E3 ubiquitin-protein ligase required during early development (PubMed:19682089).
E3 ubiquitin-protein ligases mediate ubiquitination of target proteins (PubMed:19682089).
Required for epithelial integrity and midgut morphogenesis (PubMed:19682089).
Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing (PubMed:29535189).
Its function in the WMM complex is unknown (PubMed:29535189).
E3 ubiquitin-protein ligases mediate ubiquitination of target proteins (PubMed:19682089).
Required for epithelial integrity and midgut morphogenesis (PubMed:19682089).
Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing (PubMed:29535189).
Its function in the WMM complex is unknown (PubMed:29535189).
Catalytic activity
Pathway
Protein modification; protein ubiquitination.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasmic vesicle | |
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | RNA N6-methyladenosine methyltransferase complex | |
Molecular Function | cadherin binding | |
Molecular Function | ubiquitin protein ligase activity | |
Molecular Function | ubiquitin-protein transferase activity | |
Molecular Function | zinc ion binding | |
Biological Process | actin filament organization | |
Biological Process | chitin-based cuticle development | |
Biological Process | dorsal closure | |
Biological Process | epithelial cell migration, open tracheal system | |
Biological Process | epithelium development | |
Biological Process | female sex determination | |
Biological Process | head involution | |
Biological Process | midgut development | |
Biological Process | protein ubiquitination | |
Biological Process | regulation of alternative mRNA splicing, via spliceosome | |
Biological Process | regulation of cell adhesion | |
Biological Process | segmentation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameE3 ubiquitin-protein ligase Hakai
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionM9PBE2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Lethality during larval stages. Maternal mutants show a variety of defects in epithelial integrity, including stochastic loss of shg/DE-cadherin expression, as well as defects in cell specification and cell migration.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000444614 | 1-473 | E3 ubiquitin-protein ligase Hakai | |||
Sequence: MDTEEVKRGRGRGRGTRARGRGRGRGRGRGKKIDDSSIADAAALAASSCAALEDSPGRLDASEDSVMQELDKDGELETPGALEEPLPHGALGAVAASGNMTPATQQPQVLQQVPPPVMSQTTISLSLARAVDMEADISQLEAPTFTTLSRGPPEPMLRLKWNHKVSLIGEKVLNPMIHCCDQCDKPILVYGRMIPCKHVFCLKCARAEPIKSCPRCTDKVLRVEQSGLGTVFMCTHGGSRYGSSGCRRTYLSQRDLQAHINHRHVAPQPPPLQPQPQLSAMAEQPKMTDLGGVGLGLELHKQRKLSESSVPISVSASIASRPVLSRLPLTGGVGNIGSIGSIPPPGSAAAAQNAIHGGHSTLTLANLTRINNANAQECHQGKASLHHTLKKGTPHQSESVADASYYSSVLASFGSAAGNPGSGPPGGGATAAAQPANPSGSHSAVGPGALIGGSTDAPTGGSSGNWQQSQYYR |
Proteomic databases
Expression
Developmental stage
High levels of maternal transcripts in blastoderm stage embryos are observed.
Gene expression databases
Interaction
Subunit
Component of the WMM complex, a N6-methyltransferase complex composed of a catalytic subcomplex, named MAC, and of an associated subcomplex, named MACOM (PubMed:29535189).
The MAC subcomplex is composed of Ime4/Mettl3 and Mettl14 (PubMed:29535189).
The MACOM subcomplex is composed of fl2d, Flacc/Xio, Hakai, vir, and, in some cases of nito (PubMed:29535189).
Interacts with shg/DE-cadherin (PubMed:19682089).
The MAC subcomplex is composed of Ime4/Mettl3 and Mettl14 (PubMed:29535189).
The MACOM subcomplex is composed of fl2d, Flacc/Xio, Hakai, vir, and, in some cases of nito (PubMed:29535189).
Interacts with shg/DE-cadherin (PubMed:19682089).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-37 | Disordered | ||||
Sequence: MDTEEVKRGRGRGRGTRARGRGRGRGRGRGKKIDDSS | ||||||
Compositional bias | 12-27 | Basic residues | ||||
Sequence: RGRGTRARGRGRGRGR | ||||||
Zinc finger | 180-217 | RING-type | ||||
Sequence: CDQCDKPILVYGRMIPCKHVFCLKCARAEPIKSCPRCT | ||||||
Region | 417-473 | Disordered | ||||
Sequence: AGNPGSGPPGGGATAAAQPANPSGSHSAVGPGALIGGSTDAPTGGSSGNWQQSQYYR | ||||||
Compositional bias | 456-473 | Polar residues | ||||
Sequence: DAPTGGSSGNWQQSQYYR |
Sequence similarities
Belongs to the Hakai family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
M9PBE2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameF
- Length473
- Mass (Da)49,261
- Last updated2013-06-26 v1
- ChecksumDE68D6E39E2DC120
M9PBE2-2
- NameE
- Differences from canonical
- 122-131: TISLSLARAV → I
M9PBE2-3
- NameC
M9PBE2-4
- NameA
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 12-27 | Basic residues | ||||
Sequence: RGRGTRARGRGRGRGR | ||||||
Sequence conflict | 27 | in Ref. 4; AAO41457 | ||||
Sequence: R → H | ||||||
Sequence conflict | 85 | in Ref. 4; AAO41457 | ||||
Sequence: P → S | ||||||
Alternative sequence | VSP_059629 | 122-131 | in isoform E and isoform A | |||
Sequence: TISLSLARAV → I | ||||||
Sequence conflict | 234 | in Ref. 4; AAO41457 | ||||
Sequence: C → S | ||||||
Sequence conflict | 243 | in Ref. 4; AAO41457 | ||||
Sequence: S → R | ||||||
Alternative sequence | VSP_059630 | 305-311 | in isoform C and isoform A | |||
Sequence: LSESSVP → ASGSYGS | ||||||
Alternative sequence | VSP_059631 | 312-473 | in isoform C and isoform A | |||
Sequence: Missing | ||||||
Compositional bias | 456-473 | Polar residues | ||||
Sequence: DAPTGGSSGNWQQSQYYR |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014134 EMBL· GenBank· DDBJ | AAF53834.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAN11054.3 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAN11055.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AGB93128.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY061441 EMBL· GenBank· DDBJ | AAL28989.1 EMBL· GenBank· DDBJ | mRNA | ||
BT003776 EMBL· GenBank· DDBJ | AAO41457.1 EMBL· GenBank· DDBJ | mRNA |