M4Z4A5 · M4Z4A5_9BRAD
- ProteinDNA ligase
- GeneligA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids715 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double-stranded DNA using NAD as a coenzyme and as the energy source for the reaction. It is essential for DNA replication and repair of damaged DNA.
Catalytic activity
Cofactor
Mn2+ (UniProtKB | Rhea| CHEBI:29035 )
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 49-53 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: DAAYD | ||||||
Binding site | 98-99 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: SL | ||||||
Binding site | 131 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Active site | 133 | N6-AMP-lysine intermediate | ||||
Sequence: K | ||||||
Binding site | 154 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 191 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 307 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 331 | NAD+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 436 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 438 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 466 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | DNA ligase (NAD+) activity | |
Molecular Function | metal ion binding | |
Biological Process | DNA repair | |
Biological Process | DNA replication |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA ligase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Hyphomicrobiales > Nitrobacteraceae > Bradyrhizobium
Accessions
- Primary accessionM4Z4A5
Proteomes
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 637-710 | BRCT | ||||
Sequence: KRNSPIATKTVVFTGTLEKMTRDEAKATAERLGAKVSGSVSKKTDYVVAGPGAGSKLKDAQKHGVQVLTEDEWL |
Sequence similarities
Belongs to the NAD-dependent DNA ligase family. LigA subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length715
- Mass (Da)79,814
- Last updated2013-05-29 v1
- ChecksumD581AE92F59E9F4D
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP012603 EMBL· GenBank· DDBJ | BAM87974.1 EMBL· GenBank· DDBJ | Genomic DNA |