M4TJM0 · M4TJM0_TAEAS
- ProteinCytochrome b
- Genecytb
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids217 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.
Cofactor
Note: Binds 2 heme groups non-covalently.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Molecular Function | metal ion binding | |
Molecular Function | ubiquinol-cytochrome-c reductase activity | |
Biological Process | mitochondrial electron transport, ubiquinol to cytochrome c |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytochrome b
Gene names
Encoded on
- Mitochondrion
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Spiralia > Lophotrochozoa > Platyhelminthes > Cestoda > Eucestoda > Cyclophyllidea > Taeniidae > Taenia
Accessions
- Primary accessionM4TJM0
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 15-38 | Helical | ||||
Sequence: MSYWAATVLTSIVDSLPIFGNVVY | ||||||
Transmembrane | 50-76 | Helical | ||||
Sequence: ITLIRVLSVHICLGFVILGLMVIHMFY | ||||||
Transmembrane | 107-129 | Helical | ||||
Sequence: FVLFMIVVMFVVFWLFVSPDALV | ||||||
Transmembrane | 150-180 | Helical | ||||
Sequence: WYFLSFYAILRCIGSKIGGLVLIVAFLFFLW | ||||||
Transmembrane | 192-211 | Helical | ||||
Sequence: VWRQVNFWLIVSLFFSLIYL |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-86 | Cytochrome b/b6 N-terminal region profile | ||||
Sequence: MGEAFTGYILPWHQMSYWAATVLTSIVDSLPIFGNVVYKYVVGGFSVSGITLIRVLSVHICLGFVILGLMVIHMFYLHNSGSSNPL | ||||||
Domain | 88-217 | Cytochrome b/b6 C-terminal region profile | ||||
Sequence: SFNYLSDVIYFHSYFTVKDFVLFMIVVMFVVFWLFVSPDALVDIEAYLEADSLNTPVSIKPEWYFLSFYAILRCIGSKIGGLVLIVAFLFFLWVPTNSGSSVYNVWRQVNFWLIVSLFFSLIYLGGCHPE |
Sequence similarities
Belongs to the cytochrome b family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length217
- Mass (Da)24,666
- Last updated2013-05-29 v1
- Checksum8548FA7FAF5A2C38
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: M | ||||||
Non-terminal residue | 217 | |||||
Sequence: E |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
KC621086 EMBL· GenBank· DDBJ | AGH68313.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059892 EMBL· GenBank· DDBJ | AZZ69100.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059893 EMBL· GenBank· DDBJ | AZZ69101.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059894 EMBL· GenBank· DDBJ | AZZ69102.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059895 EMBL· GenBank· DDBJ | AZZ69103.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059896 EMBL· GenBank· DDBJ | AZZ69104.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059897 EMBL· GenBank· DDBJ | AZZ69105.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059898 EMBL· GenBank· DDBJ | AZZ69106.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059899 EMBL· GenBank· DDBJ | AZZ69107.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059900 EMBL· GenBank· DDBJ | AZZ69108.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059901 EMBL· GenBank· DDBJ | AZZ69109.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059902 EMBL· GenBank· DDBJ | AZZ69110.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059903 EMBL· GenBank· DDBJ | AZZ69111.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059904 EMBL· GenBank· DDBJ | AZZ69112.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059905 EMBL· GenBank· DDBJ | AZZ69113.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059906 EMBL· GenBank· DDBJ | AZZ69114.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059907 EMBL· GenBank· DDBJ | AZZ69115.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MK059908 EMBL· GenBank· DDBJ | AZZ69116.1 EMBL· GenBank· DDBJ | Genomic DNA |