M1W426 · TCPG_CLAP2
- ProteinGlutathione S-transferase tcpG
- GenetcpG
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids249 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Glutathione S-transferase; part of the gene cluster that mediates the biosynthesis of an unusual class of epipolythiodioxopiperazines (ETPs) lacking the reactive thiol group important for toxicity (PubMed:27390873).
Firstly, L-tyrosine is prenylated by tcpD, before undergoing condensation with L-glycine in a reaction catalyzed by the NRPS tcpP leading to the diketopiperazine (DKP) backbone (PubMed:27390873).
Afterwards the alpha-carbon of tyrosine is oxidized by the cytochrome P450 tcpC to form a hydroxyl group (PubMed:27390873).
However, in contrast other ETP biosynthesis pathways studied so far, tcpC is not able to bishydroxylate the DKP at both alpha-carbon positions, but hydroxylates the alpha-carbon of the tyrosine part and the nitrogen of the glycine part (PubMed:27390873).
The next steps involve an alpha,beta-elimination reaction catalyzed by tcpI, a methylation by the methyltransferase tcpN the action of the four enzyme cascade tcpG/K/J/I (PubMed:27390873).
Due to a dysfunctional cytochrome P450 monooxygenase tcpC, the pathway leads to the biosynthesis of probable non-toxic metabolites lacking the reactive thiol group (PubMed:27390873).
Firstly, L-tyrosine is prenylated by tcpD, before undergoing condensation with L-glycine in a reaction catalyzed by the NRPS tcpP leading to the diketopiperazine (DKP) backbone (PubMed:27390873).
Afterwards the alpha-carbon of tyrosine is oxidized by the cytochrome P450 tcpC to form a hydroxyl group (PubMed:27390873).
However, in contrast other ETP biosynthesis pathways studied so far, tcpC is not able to bishydroxylate the DKP at both alpha-carbon positions, but hydroxylates the alpha-carbon of the tyrosine part and the nitrogen of the glycine part (PubMed:27390873).
The next steps involve an alpha,beta-elimination reaction catalyzed by tcpI, a methylation by the methyltransferase tcpN the action of the four enzyme cascade tcpG/K/J/I (PubMed:27390873).
Due to a dysfunctional cytochrome P450 monooxygenase tcpC, the pathway leads to the biosynthesis of probable non-toxic metabolites lacking the reactive thiol group (PubMed:27390873).
Catalytic activity
- RX + glutathione = an S-substituted glutathione + a halide anion + H+
Pathway
Secondary metabolite biosynthesis.
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | glutathione transferase activity |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlutathione S-transferase tcpG
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Hypocreomycetidae > Hypocreales > Clavicipitaceae > Claviceps
Accessions
- Primary accessionM1W426
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000437726 | 1-249 | Glutathione S-transferase tcpG | |||
Sequence: MEAQQDFTKHPEVAQDRLVLYVRKAIPAPTANSLKPLMILEALEIPYSIHLISSLSQETWYHEINPYKQLPALEDIDLVETSGGSKRRLNVFDSSAMLIYLCDKHDKDGLFIGRNATERAQVTSWLIAYAAGLGATGEWWLKMRHDENLKPALRVIENAIRREYDILEKRLGEPGQRWIALADRPTVADFAIQPLANPRVARNAAIDFEAWPRTKAWSEAVDRLAYIDRAKRLNNKLGMTEEEIELHGR |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 20-109 | GST N-terminal | ||||
Sequence: LYVRKAIPAPTANSLKPLMILEALEIPYSIHLISSLSQETWYHEINPYKQLPALEDIDLVETSGGSKRRLNVFDSSAMLIYLCDKHDKDG | ||||||
Domain | 115-249 | GST C-terminal | ||||
Sequence: NATERAQVTSWLIAYAAGLGATGEWWLKMRHDENLKPALRVIENAIRREYDILEKRLGEPGQRWIALADRPTVADFAIQPLANPRVARNAAIDFEAWPRTKAWSEAVDRLAYIDRAKRLNNKLGMTEEEIELHGR |
Sequence similarities
Belongs to the GST superfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length249
- Mass (Da)28,456
- Last updated2013-05-01 v1
- Checksum602611604899E39D
Keywords
- Technical term