M1EAP5 · ACB1_BPS16
- ProteinAnti-CBASS protein Acb1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids152 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Counteracts the host CBASS antiviral defense system. Phosphodiesterase that enables metal-independent hydrolysis of the host cyclic di- and trinucleotide CBASS signals such as 3'3'-cGAMP, 3'3'cUA, and 3'3'3'-cAAA (PubMed:35395152).
Does not cleave cGG or cA4 (By similarity).
Besides evasion of the CBASS system, might also enable evasion of the type III CRISPR systems that use cA3 signals (By similarity).
Does not cleave cGG or cA4 (By similarity).
Besides evasion of the CBASS system, might also enable evasion of the type III CRISPR systems that use cA3 signals (By similarity).
Catalytic activity
- 3',3'-cUAMP + H2O = H+ + U[3'-5']pAp[3']This reaction proceeds in the forward direction.
- 3',3',3'-c-tri-AMP + H2O = A[3'-5']pA[3'-5']pAp[3'] + H+This reaction proceeds in the forward direction.
- 3',3',3'-cAAG + H2O = G[3'-5']pA[3'-5']pAp[3'] + H+This reaction proceeds in the forward direction.
- 3',3',3'-cAAG + H2O = A[3'-5']pG[3'-5']pAp[3'] + H+This reaction proceeds in the forward direction.
- 3',3'-cGAMP + H2O = G[3'-5']pAp[3'] + H+This reaction proceeds in the forward direction.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 12 | 3',3'-cGAMP (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 12 | 3',3'-cUAMP (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Active site | 44 | |||||
Sequence: H | ||||||
Active site | 46 | |||||
Sequence: T | ||||||
Active site | 113 | |||||
Sequence: H | ||||||
Active site | 115 | |||||
Sequence: T | ||||||
Binding site | 141 | 3',3'-cGAMP (UniProtKB | ChEBI); specific to adenosine | ||||
Sequence: E | ||||||
Binding site | 141 | 3',3'-cUAMP (UniProtKB | ChEBI); specific to adenosine | ||||
Sequence: E | ||||||
Binding site | 147 | 3',3'-cGAMP (UniProtKB | ChEBI) | ||||
Sequence: W | ||||||
Binding site | 147 | 3',3'-cUAMP (UniProtKB | ChEBI) | ||||
Sequence: W |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | hydrolase activity | |
Biological Process | symbiont-mediated suppression of host innate immune response | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAnti-CBASS protein Acb1
- Short namesAcb1
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Uroviricota > Caudoviricetes > Straboviridae > Tevenvirinae > Gelderlandvirus > Gelderlandvirus s16
- Virus hosts
Accessions
- Primary accessionM1EAP5
Proteomes
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000456661 | 1-152 | Anti-CBASS protein Acb1 | |||
Sequence: MMKFQDFSSGLYVAAKFSDSTLDEIENLQRELKVPNPVPRHKIHSTICYSRVNVPYVVSTGSFEVANSGELQVWDTQDGRTLVLVLDSDYLKFRHNYARALGATHDFDDYSPHITLSYNVGPAQFSGIVQVPVILDREYKEPLKINWTEDLK |
Family & Domains
Sequence similarities
Belongs to the anti-CBASS protein Acb1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length152
- Mass (Da)17,356
- Last updated2013-05-01 v1
- Checksum509221B158FA7B94
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HQ331142 EMBL· GenBank· DDBJ | AEO97082.1 EMBL· GenBank· DDBJ | Genomic DNA |