M0RAA8 · M0RAA8_RAT

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentapical plasma membrane
Cellular Componentbasolateral plasma membrane
Cellular Componentcytoplasm
Cellular Componentearly endosome membrane
Cellular Componentearly phagosome
Cellular Componentendolysosome
Cellular Componentendoplasmic reticulum
Cellular Componentendoplasmic reticulum membrane
Cellular Componentendosome
Cellular Componentlysosome
Cellular Componentphagocytic vesicle
Cellular Componentplasma membrane
Molecular Functioninterleukin-1 receptor binding
Molecular Functionpattern recognition receptor activity
Molecular FunctionsiRNA binding
Molecular Functionunmethylated CpG binding
Biological Processactivation of innate immune response
Biological Processcanonical NF-kappaB signal transduction
Biological Processcellular response to chloroquine
Biological Processcellular response to lipopolysaccharide
Biological Processcellular response to metal ion
Biological Processdefense response to Gram-negative bacterium
Biological Processdefense response to virus
Biological Processdetection of molecule of bacterial origin
Biological Processimmune response
Biological Processinnate immune response
Biological Processmaintenance of gastrointestinal epithelium
Biological Processmale gonad development
Biological Processmicroglial cell activation
Biological ProcessMyD88-dependent toll-like receptor signaling pathway
Biological Processnegative regulation of ERK1 and ERK2 cascade
Biological Processpositive regulation of autophagy
Biological Processpositive regulation of B cell activation
Biological Processpositive regulation of B cell proliferation
Biological Processpositive regulation of canonical NF-kappaB signal transduction
Biological Processpositive regulation of chemokine production
Biological Processpositive regulation of cytokine production
Biological Processpositive regulation of gene expression
Biological Processpositive regulation of granulocyte macrophage colony-stimulating factor production
Biological Processpositive regulation of immunoglobulin production
Biological Processpositive regulation of interferon-alpha production
Biological Processpositive regulation of interferon-beta production
Biological Processpositive regulation of interleukin-10 production
Biological Processpositive regulation of interleukin-12 production
Biological Processpositive regulation of interleukin-18 production
Biological Processpositive regulation of interleukin-6 production
Biological Processpositive regulation of interleukin-8 production
Biological Processpositive regulation of intestinal epithelial cell development
Biological Processpositive regulation of JNK cascade
Biological Processpositive regulation of MAPK cascade
Biological Processpositive regulation of non-canonical NF-kappaB signal transduction
Biological Processpositive regulation of toll-like receptor 9 signaling pathway
Biological Processpositive regulation of transcription by RNA polymerase II
Biological Processpositive regulation of tumor necrosis factor production
Biological Processpositive regulation of type II interferon production
Biological Processregulation of B cell activation
Biological Processregulation of B cell differentiation
Biological Processregulation of dendritic cell cytokine production
Biological Processregulation of inflammatory response
Biological Processregulation of protein phosphorylation
Biological Processregulation of toll-like receptor 9 signaling pathway
Biological Processresponse to virus
Biological Processtoll-like receptor 9 signaling pathway
Biological Processtoll-like receptor signaling pathway

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    Toll-like receptor 9

Gene names

    • Name
      Tlr9

Organism names

  • Taxonomic identifier
  • Organism
  • Strain
    • Brown Norway
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus

Accessions

  • Primary accession
    M0RAA8

Proteomes

Organism-specific databases

Subcellular Location

Keywords

PTM/Processing

Keywords

Proteomic databases

Expression

Gene expression databases

Interaction

Protein-protein interaction databases

Structure

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain868-1013TIR

Sequence similarities

Belongs to the Toll-like receptor family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    1,032
  • Mass (Da)
    116,717
  • Last updated
    2013-04-03 v1
  • Checksum
    152B2883DB0A2376
MVLCRRTLHPLSLLVQAAMLAEALALGTLPAFLPCELKPHGLVDCNWLFLKSVPHFSAAEPRSNITSLSLIANRIHHLHNLDFVHLPNVRQLNLKWNCPPPGLSPLHFSCRMTIEPKTFLAMRMLEELNLSYNGITTVPRLPSSLTNLSLSHTNILVLDASSLAGLHSLRVLFMDGNCYYKNPCNGAVNVTPDAFLGLSNLTHLSLKYNNLTEVPRQLPSSLEYLLLSYNLIVKLGPEDLANLTSLRVLDVGGNCRRCDHAPDLCTECRQKSLDLHPQTFRHLSHLEGLVLKDSSLHSLNSKWFQGLVNLSVLDLSENFLYESINKTSAFQNLTRLRKLDLSFNYCKKVSFARLHLASSFKSLVSLQELNMNGIFFRLLNKNTLRWLAGLPKLHTLHLQMNFINQAQLSVFSTFRALRFVDLSNNRISGPPTLSRVAPEKADEAEKGVPWPASLTPALPSTPVSKNFMVRCKNLRFTMDLSRNNLVTIKPEMFVNLSHLQCLSLSHNCIAQAVNGSQFLPLTNLKVLDLSYNKLDLYHSKSFSELPQLQALDLSYNSQPFSMQGIGHNFSFLANLSRLQNLSLAHNDIHSRVSSRLYSTSVEYLDFSGNGVGRMWDEEDLYLYFFQDLRSLIHLDLSQNKLHILRPQNLNYLPKSLTKLSFRDNHLSFFNWSSLAFLPNLRDLDLAGNLLKALTNGTLPNGTLLQKLDVSSNSIVFVVPAFFALAVELKEVNLSHNILKTVDRSWFGPIVMNLTVLDVSSNPLHCACGAPFVDLLLEVQTKVPGLANGVKCGSPRQLQGRSIFAQDLRLCLDDVLSRDCFGLSLLAVAVGTVLPLLQHLCGWDVWYCFHLCLAWLPLLTRGRRSAQALPYDAFVVFDKAQSAVADWVYNELRVRLEERRGRRALRLCLEDRDWLPGQTLFENLWASIYGSRKTLFVLAHTDKVSGLLRTSFLLAQQRLLEDRKDVVVLVILRPDAHRSRYVRLRQRLCRQSVLFWPHQPNGQGSFWAQLSTALTRDNHHFYNRNFCRGPTAE

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp