L8IWW9 · L8IWW9_9CETA

  • Protein
    Cyclin-dependent kinase inhibitor 1B
  • Status
    UniProtKB unreviewed (TrEMBL)
  • Amino acids
  • Protein existence
    Inferred from homology
  • Annotation score
    5/5

Function

function

Important regulator of cell cycle progression. Inhibits the kinase activity of CDK2 bound to cyclin A, but has little inhibitory activity on CDK2 bound to SPDYA. Involved in G1 arrest. Potent inhibitor of cyclin E- and cyclin A-CDK2 complexes. Forms a complex with cyclin type D-CDK4 complexes and is involved in the assembly, stability, and modulation of CCND1-CDK4 complex activation. Acts either as an inhibitor or an activator of cyclin type D-CDK4 complexes depending on its phosphorylation state and/or stoichometry.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular ComponentCul4A-RING E3 ubiquitin ligase complex
Cellular Componentcytosol
Cellular Componentendosome
Cellular Componentnucleoplasm
Molecular Functioncyclin binding
Molecular Functioncyclin-dependent protein serine/threonine kinase inhibitor activity
Molecular Functionprotein kinase binding
Molecular Functionprotein phosphatase binding
Molecular Functionprotein-containing complex binding
Molecular Functionprotein-folding chaperone binding
Biological Processautophagic cell death
Biological Processcellular response to antibiotic
Biological Processcellular response to lithium ion
Biological Processcellular response to organic cyclic compound
Biological Processepithelial cell apoptotic process
Biological Processepithelial cell proliferation involved in prostate gland development
Biological ProcessG1/S transition of mitotic cell cycle
Biological Processheart development
Biological Processinner ear development
Biological Processnegative regulation of cardiac muscle tissue regeneration
Biological Processnegative regulation of cell growth
Biological Processnegative regulation of cyclin-dependent protein serine/threonine kinase activity
Biological Processnegative regulation of DNA-templated transcription
Biological Processnegative regulation of epithelial cell apoptotic process
Biological Processnegative regulation of epithelial cell proliferation involved in prostate gland development
Biological Processnegative regulation of mitotic cell cycle
Biological Processnegative regulation of vascular associated smooth muscle cell proliferation
Biological ProcessNotch signaling pathway
Biological Processnuclear export
Biological Processplacenta development
Biological Processpositive regulation of cell population proliferation
Biological Processpositive regulation of microtubule polymerization
Biological Processpositive regulation of protein catabolic process
Biological Processpotassium ion transport
Biological Processregulation of cell migration
Biological Processregulation of exit from mitosis
Biological Processregulation of G1/S transition of mitotic cell cycle
Biological Processregulation of lens fiber cell differentiation
Biological Processsensory perception of sound

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Cyclin-dependent kinase inhibitor 1B
  • Alternative names
    • Cyclin-dependent kinase inhibitor p27
    • p27Kip1

Gene names

    • ORF names
      M91_15891

Organism names

  • Taxonomic identifier
  • Organism
  • Strain
    • yakQH1
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos

Accessions

  • Primary accession
    L8IWW9

Proteomes

Subcellular Location

Keywords

PTM/Processing

Keywords

Interaction

Protein-protein interaction databases

Structure

Family & Domains

Features

Showing features for region, domain, compositional bias.

TypeIDPosition(s)Description
Region1-22Disordered
Domain31-79Cyclin-dependent kinase inhibitor
Region85-198Disordered
Compositional bias158-172Basic and acidic residues

Sequence similarities

Belongs to the CDI family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    198
  • Mass (Da)
    22,090
  • Last updated
    2013-04-03 v1
  • Checksum
    029DDB3BE407C410
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFKNHKPLEGKYEWQEVEKGSLPEFYHRPPRPPKGACKVPAQEGQDASGARPAVPLLGSQANPEDTHLVDQKTDAPDSQTGLAEQCPGIRKRPAADDSSPQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Features

Showing features for compositional bias.

TypeIDPosition(s)Description
Compositional bias158-172Basic and acidic residues

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
JH880581
EMBL· GenBank· DDBJ
ELR60493.1
EMBL· GenBank· DDBJ
Genomic DNA

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp