K9ZIK8 · K9ZIK8_ANACC
- ProteinCarbamoyl phosphate synthase small chain
- GenecarA
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids385 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Small subunit of the glutamine-dependent carbamoyl phosphate synthetase (CPSase). CPSase catalyzes the formation of carbamoyl phosphate from the ammonia moiety of glutamine, carbonate, and phosphate donated by ATP, constituting the first step of 2 biosynthetic pathways, one leading to arginine and/or urea and the other to pyrimidine nucleotides. The small subunit (glutamine amidotransferase) binds and cleaves glutamine to supply the large subunit with the substrate ammonia.
Catalytic activity
- hydrogencarbonate + L-glutamine + 2 ATP + H2O = carbamoyl phosphate + L-glutamate + 2 ADP + phosphate + 2 H+
- L-glutamine + H2O = L-glutamate + NH4+
Pathway
Amino-acid biosynthesis; L-arginine biosynthesis; carbamoyl phosphate from bicarbonate: step 1/1.
Pyrimidine metabolism; UMP biosynthesis via de novo pathway; (S)-dihydroorotate from bicarbonate: step 1/3.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 51 | L-glutamine (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 244 | L-glutamine (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 246 | L-glutamine (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Active site | 272 | Nucleophile | ||||
Sequence: C | ||||||
Binding site | 273 | L-glutamine (UniProtKB | ChEBI) | ||||
Sequence: M | ||||||
Binding site | 276 | L-glutamine (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 312 | L-glutamine (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 315 | L-glutamine (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Active site | 355 | |||||
Sequence: H | ||||||
Active site | 357 | |||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | carbamoyl-phosphate synthase complex | |
Molecular Function | ATP binding | |
Molecular Function | carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity | |
Molecular Function | glutaminase activity | |
Biological Process | 'de novo' pyrimidine nucleobase biosynthetic process | |
Biological Process | 'de novo' UMP biosynthetic process | |
Biological Process | arginine biosynthetic process | |
Biological Process | glutamine metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCarbamoyl phosphate synthase small chain
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Cyanobacteriota > Cyanophyceae > Nostocales > Nostocaceae > Anabaena
Accessions
- Primary accessionK9ZIK8
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Subunit
Composed of two chains; the small (or glutamine) chain promotes the hydrolysis of glutamine to ammonia, which is used by the large (or ammonia) chain to synthesize carbamoyl phosphate. Tetramer of heterodimers (alpha,beta)4.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-195 | CPSase | ||||
Sequence: MSLSDAIPALLVLADGTTYRGWSFGAMGTAIGEVVFNTGMTGYQEVLTDPSYSGQIVIFTYPELGNTGVNLEDEESAKPHVRGAIARNICHKPSNWRSTQSLPDYLKQHQVPGIFGIDTRALTRKIRMFGAMNGGISTSILDEAELLELVQAAPNMAGLNLVQEVTTPTVYEWSEATTAAWEFNPENVAKISETF | ||||||
Domain | 7-137 | Carbamoyl-phosphate synthase small subunit N-terminal | ||||
Sequence: IPALLVLADGTTYRGWSFGAMGTAIGEVVFNTGMTGYQEVLTDPSYSGQIVIFTYPELGNTGVNLEDEESAKPHVRGAIARNICHKPSNWRSTQSLPDYLKQHQVPGIFGIDTRALTRKIRMFGAMNGGIS |
Sequence similarities
Belongs to the CarA family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length385
- Mass (Da)41,792
- Last updated2013-03-06 v1
- ChecksumD27FCA3C46492F3E
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP003659 EMBL· GenBank· DDBJ | AFZ59036.1 EMBL· GenBank· DDBJ | Genomic DNA |