K9WWI5 · K9WWI5_9NOST
- ProteinPolyketide synthase family protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids2241 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
function
Fatty acid synthetase is a multifunctional enzyme that catalyzes the de novo biosynthesis of long-chain saturated fatty acids starting from acetyl-CoA and malonyl-CoA in the presence of NADPH. This multifunctional protein contains 7 catalytic activities and a site for the binding of the prosthetic group 4'-phosphopantetheine of the acyl carrier protein ([ACP]) domain.
Catalytic activity
- (2E)-butenoyl-[ACP] + H+ + NADPH = butanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-decenoyl-[ACP] + H+ + NADPH = decanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-dodecenoyl-[ACP] + H+ + NADPH = dodecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-hexadecenoyl-[ACP] + H+ + NADPH = hexadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-hexenoyl-[ACP] + H+ + NADPH = hexanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-octadecenoyl-[ACP] + H+ + NADPH = NADP+ + octadecanoyl-[ACP]This reaction proceeds in the forward direction.
- (2E)-octenoyl-[ACP] + H+ + NADPH = NADP+ + octanoyl-[ACP]This reaction proceeds in the forward direction.
- (2E)-tetradecenoyl-[ACP] + H+ + NADPH = NADP+ + tetradecanoyl-[ACP]This reaction proceeds in the forward direction.
- (3R)-hydroxybutanoyl-[ACP] = (2E)-butenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxydecanoyl-[ACP] = (2E)-decenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxydodecanoyl-[ACP] = (2E)-dodecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyhexadecanoyl-[ACP] = (2E)-hexadecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyhexanoyl-[ACP] = (2E)-hexenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyoctadecanoyl-[ACP] = (2E)-octadecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyoctanoyl-[ACP] = (2E)-octenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxytetradecanoyl-[ACP] = (2E)-tetradecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- 3-oxobutanoyl-[ACP] + H+ + NADPH = (3R)-hydroxybutanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxodecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxydecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxododecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxydodecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxohexadecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxyhexadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxohexanoyl-[ACP] + H+ + NADPH = (3R)-hydroxyhexanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxooctadecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxyoctadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxooctanoyl-[ACP] + H+ + NADPH = (3R)-hydroxyoctanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxotetradecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxytetradecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- H+ + hexadecanoyl-[ACP] + malonyl-[ACP] = 3-oxooctadecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- H+ + hexanoyl-[ACP] + malonyl-[ACP] = 3-oxooctanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- H+ + malonyl-[ACP] + octanoyl-[ACP] = 3-oxodecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- H+ + malonyl-[ACP] + tetradecanoyl-[ACP] = 3-oxohexadecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- acetyl-[ACP] + H+ + malonyl-[ACP] = 3-oxobutanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- butanoyl-[ACP] + H+ + malonyl-[ACP] = 3-oxohexanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- decanoyl-[ACP] + H+ + malonyl-[ACP] = 3-oxododecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- dodecanoyl-[ACP] + H+ + malonyl-[ACP] = 3-oxotetradecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
Pathway
Lipid metabolism.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | (3R)-hydroxyacyl-[acyl-carrier-protein] dehydratase activity | |
Molecular Function | 3-hydroxyacyl-CoA dehydrogenase activity | |
Molecular Function | 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity | |
Molecular Function | 3-oxoacyl-[acyl-carrier-protein] synthase activity | |
Molecular Function | [acyl-carrier-protein] S-acetyltransferase activity | |
Molecular Function | [acyl-carrier-protein] S-malonyltransferase activity | |
Molecular Function | enoyl-[acyl-carrier-protein] reductase (NADPH) activity | |
Molecular Function | fatty acid synthase activity | |
Molecular Function | fatty acyl-[ACP] hydrolase activity | |
Molecular Function | phosphopantetheine binding | |
Biological Process | DIM/DIP cell wall layer assembly | |
Biological Process | fatty acid biosynthetic process |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageBacteria > Cyanobacteriota > Cyanophyceae > Nostocales > Nostocaceae > Cylindrospermum
Accessions
- Primary accessionK9WWI5
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Keywords
- PTM
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 893-1319 | Ketosynthase family 3 (KS3) | ||||
Sequence: NTDIAIIGISCRYPGAKNWQEFWKNLKNGVDSVTEAPPGRWQEKEWYHPDPEHVGTSYSKCAGFLDEIDKFDPLFFQISPVEAQFIEPQQRIFLEEAYHAIEDAGYATDSLKGKQCGVFVGAGTNGDYNKLLSIAGLDTHRLALTGNLLSMIPARIAYFLDLRGPVVAIDTACSSSLVAVHQACESIQRGESELAIAGGIAIMATADFQVLSSQFQMLSAAGRCKTFDAEASGTVWSEGCGVVLLKSYEQAIRDNDHIYAVIKGTGVNYDGNTNGISAPSGQSQTRLEEGVYQKFGINPETISYVEAHGTATPLGDPIEVEGLTEAFSKWTTKKQFCAIGSVKTNIGHAATSAGISGLIKTILCLKNQKLVPSLHFNQPNPHIDFENSPFYVNTEFKDWQVTDRNPRRATVSSFGFSGTNAHLVIEE | ||||||
Region | 1849-1874 | Disordered | ||||
Sequence: ESNAHQNESAKTDEKIVSPSASEPSS | ||||||
Domain | 1889-1965 | Carrier | ||||
Sequence: QLLRTYIGQILAKVVGISPAALNWQKRLSELGFDSLMAADLRKTIDSNLKVSVPVEYLAELNIEQFLTQILYLIEQK |
Sequence similarities
Belongs to the enoyl-CoA hydratase/isomerase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,241
- Mass (Da)250,092
- Last updated2013-03-06 v1
- Checksum844296E7A228E476
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP003642 EMBL· GenBank· DDBJ | AFZ24141.1 EMBL· GenBank· DDBJ | Genomic DNA |