K7GFW6 · K7GFW6_PELSI
- ProteinProstaglandin reductase 1
- GenePTGR1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids328 (go to sequence)
- Protein existenceInferred from homology
- Annotation score5/5
Function
Catalytic activity
- (5S,12S)-dihydroxy-(6E,10E,12E,14Z)-eicosatetraenoate + NADP+ = 12-oxo-(5S)-hydroxy-(6E,8E,10E,14Z)-eicosatetraenoate + NADPH + H+This reaction proceeds in the forward direction.
- 13,14-dihydro-15-oxo-PGF2alpha + NADP+ = 15-oxoprostaglandin F2alpha + NADPH + H+This reaction proceeds in the backward direction.
- 13,14-dihydro-15-oxo-prostaglandin E1 + NADP+ = 15-oxoprostaglandin E1 + NADPH + H+This reaction proceeds in the backward direction.
- 13,14-dihydro-15-oxo-prostaglandin F1alpha + NADP+ = 15-oxoprostaglandin F1alpha + NADPH + H+This reaction proceeds in the backward direction.
- 20-hydroxy-leukotriene B4 + NADP+ = 12-oxo-20-hydroxy-leukotriene B4 + NADPH + H+This reaction proceeds in the forward direction.
- 4-hydroxynonanal + NADP+ = (E)-4-hydroxynon-2-enal + NADPH + H+This reaction proceeds in the backward direction.
- 6-trans-leukotriene B4 + NADP+ = 12-oxo-(5S)-hydroxy-(6E,8E,10E,14Z)-eicosatetraenoate + NADPH + H+This reaction proceeds in the forward direction.
- nonan-2-one + NADP+ = (3E)-nonen-2-one + NADPH + H+This reaction proceeds in the backward direction.
- octanal + NADP+ = (2E)-octenal + NADPH + H+This reaction proceeds in the backward direction.
- pentan-2-one + NADP+ = (E)-pent-3-en-2-one + NADPH + H+This reaction proceeds in the backward direction.
- decanal + NADP+ = (2E)-decenal + NADPH + H+This reaction proceeds in the backward direction.
- dodecanal + NADP+ = (2E)-dodecenal + NADPH + H+This reaction proceeds in the backward direction.
- hexanal + NADP+ = (E)-hex-2-enal + NADPH + H+This reaction proceeds in the backward direction.
- leukotriene B4 + NADP+ = 12-oxo-leukotriene B4 + NADPH + H+This reaction proceeds in the forward direction.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | 15-oxoprostaglandin 13-oxidase [NAD(P)+] activity | |
Molecular Function | 2-alkenal reductase (NADPH) activity | |
Biological Process | prostaglandin metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProstaglandin reductase 1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Testudinata > Testudines > Cryptodira > Trionychia > Trionychidae > Pelodiscus
Accessions
- Primary accessionK7GFW6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Keywords
- PTM
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 15-326 | Enoyl reductase (ER) | ||||
Sequence: GFPKDSDFELKEVELPKLKDGDVLFESVFLSVDPYMRPYSTRSMKEGDTMMGTQVARVVESKNPTYPVGTYVVANSGWRTHFISDGKDLHLLPFWPEKIPRSLALGTIGMPGLTAYFGLFEICKIRAGDTVLVTAAAGAVGSVVGQLAKIGGCKVVGCAGSDKKVAYLKQIGFDEAFNYKTVGSLEEALKKASPDGYDCYFDNVGGEFSSIALNQMKRFGRIAVCGAISGYNDTVPQKGPYVQIPMLFNQLSMEGFIVSRWNDKREEALKRLLKWVVEGKIKCEEHVTEGFEKMPAAFMGMLKGENLGKAVV |
Sequence similarities
Belongs to the NADP-dependent oxidoreductase L4BD family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length328
- Mass (Da)36,174
- Last updated2013-01-09 v1
- ChecksumBC650B1563DDF2ED
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AGCU01057197 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AGCU01057198 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AGCU01057199 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |