K7G7J8 · K7G7J8_PELSI

Function

function

Modulates the RNA-binding activity of ACO1. May be involved in the cytoplasmic iron-sulfur protein biogenesis. May contribute to oxidative stress resistance and overall cell survival.

Catalytic activity

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentmitochondrial [2Fe-2S] assembly complex
Molecular Function2 iron, 2 sulfur cluster binding
Molecular Functionferric iron binding
Molecular Functionferrous iron binding
Molecular Functionferroxidase activity
Molecular Functioniron chaperone activity
Biological Process[2Fe-2S] cluster assembly
Biological Process[4Fe-4S] cluster assembly
Biological Processadult walking behavior
Biological Processcellular response to hydrogen peroxide
Biological Processembryo development ending in birth or egg hatching
Biological Processintracellular iron ion homeostasis
Biological Processiron incorporation into metallo-sulfur cluster
Biological Processiron ion transport
Biological Processmitochondrion organization
Biological Processmuscle cell cellular homeostasis
Biological Processnegative regulation of multicellular organism growth
Biological Processnegative regulation of organ growth
Biological Processnegative regulation of release of cytochrome c from mitochondria
Biological Processorgan growth
Biological Processoxidative phosphorylation
Biological Processpositive regulation of aconitate hydratase activity
Biological Processpositive regulation of cell growth
Biological Processpositive regulation of cell population proliferation
Biological Processpositive regulation of succinate dehydrogenase activity
Biological Processproprioception
Biological Processprotein autoprocessing
Biological Processregulation of ferrochelatase activity
Biological Processresponse to iron ion

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    Frataxin, mitochondrial
  • EC number

Gene names

    • Name
      FXN

Organism names

Accessions

  • Primary accession
    K7G7J8

Proteomes

Subcellular Location

Keywords

Interaction

Subunit

Interacts with ACO1. Interacts with ISCU (cytoplasmic form).

Protein-protein interaction databases

Family & Domains

Sequence similarities

Belongs to the frataxin family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    159
  • Mass (Da)
    17,729
  • Last updated
    2013-01-09 v1
  • MD5 Checksum
    E9F6FE6D0D23599FAA1A198112A007C3
LQQLDRVLKIKNNSVHFIHLRNAGTLNDKSSLDESTYEKLAEETLDSLADFFEDLADKPFTPEDYDVSFGNGVLTAKLGGDMGTYVINKQTPNKQIWLSSPTSGPKRYDWTGRNWVYCHDGVSLHELLAVELSKALKTKIDLSPLAYSGKASLCCVTIM

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AGCU01194672
EMBL· GenBank· DDBJ
-Genomic DNA No translation available.

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
Help