K7FAD5 · K7FAD5_PELSI

Function

Caution

Lacks conserved residue(s) required for the propagation of feature annotation.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcell surface
Cellular Componentcollagen-containing extracellular matrix
Cellular Componentcytosol
Cellular Componentextracellular space
Molecular Functioncysteine-type endopeptidase activity
Molecular Functionfrizzled binding
Molecular Functionheparin binding
Molecular Functionidentical protein binding
Molecular FunctionWnt-protein binding
Biological ProcessBMP signaling pathway
Biological Processbone trabecula formation
Biological Processcanonical Wnt signaling pathway
Biological Processcellular response to estradiol stimulus
Biological Processcellular response to estrogen stimulus
Biological Processcellular response to fibroblast growth factor stimulus
Biological Processcellular response to heparin
Biological Processcellular response to hypoxia
Biological Processcellular response to interleukin-1
Biological Processcellular response to prostaglandin E stimulus
Biological Processcellular response to starvation
Biological Processcellular response to transforming growth factor beta stimulus
Biological Processcellular response to tumor necrosis factor
Biological Processcellular response to vitamin D
Biological Processcellular response to X-ray
Biological Processconvergent extension involved in somitogenesis
Biological Processdigestive tract morphogenesis
Biological Processdopaminergic neuron differentiation
Biological Processdorsal/ventral axis specification
Biological Processextrinsic apoptotic signaling pathway
Biological Processfemale gonad development
Biological Processhematopoietic stem cell differentiation
Biological Processmale gonad development
Biological Processnegative regulation of androgen receptor signaling pathway
Biological Processnegative regulation of B cell differentiation
Biological Processnegative regulation of BMP signaling pathway
Biological Processnegative regulation of bone remodeling
Biological Processnegative regulation of canonical Wnt signaling pathway
Biological Processnegative regulation of cell growth
Biological Processnegative regulation of cell migration
Biological Processnegative regulation of DNA-templated transcription
Biological Processnegative regulation of epithelial cell proliferation
Biological Processnegative regulation of epithelial to mesenchymal transition
Biological Processnegative regulation of fibroblast apoptotic process
Biological Processnegative regulation of fibroblast proliferation
Biological Processnegative regulation of gene expression
Biological Processnegative regulation of insulin secretion
Biological Processnegative regulation of ossification
Biological Processnegative regulation of osteoblast differentiation
Biological Processnegative regulation of osteoblast proliferation
Biological Processnegative regulation of osteoclast differentiation
Biological Processnegative regulation of peptidyl-tyrosine phosphorylation
Biological Processnegative regulation of planar cell polarity pathway involved in axis elongation
Biological Processneural crest cell fate commitment
Biological Processosteoblast differentiation
Biological Processosteoclast differentiation
Biological Processplanar cell polarity pathway involved in axis elongation
Biological Processplanar cell polarity pathway involved in neural tube closure
Biological Processpositive regulation of canonical Wnt signaling pathway
Biological Processpositive regulation of cell growth
Biological Processpositive regulation of DNA-templated transcription
Biological Processpositive regulation of epithelial cell proliferation
Biological Processpositive regulation of extrinsic apoptotic signaling pathway via death domain receptors
Biological Processpositive regulation of fat cell differentiation
Biological Processpositive regulation of fibroblast apoptotic process
Biological Processpositive regulation of non-canonical Wnt signaling pathway
Biological Processpositive regulation of smoothened signaling pathway
Biological Processprostate epithelial cord arborization involved in prostate glandular acinus morphogenesis
Biological Processregulation of branching involved in prostate gland morphogenesis
Biological Processregulation of cell cycle process
Biological Processregulation of midbrain dopaminergic neuron differentiation
Biological Processregulation of neuron projection development
Biological Processresponse to xenobiotic stimulus
Biological Processsomatic stem cell population maintenance
Biological Processstromal-epithelial cell signaling involved in prostate gland development
Biological Processureteric bud development
Biological ProcessWnt signaling pathway involved in somitogenesis

Keywords

Protein family/group databases

Names & Taxonomy

Protein names

  • Recommended name
    Secreted frizzled-related protein 1

Gene names

    • Name
      SFRP1

Organism names

Accessions

  • Primary accession
    K7FAD5

Proteomes

Subcellular Location

Keywords

  • Cellular component

PTM/Processing

Features

Showing features for signal, chain, disulfide bond.

TypeIDPosition(s)Description
Signal1-31
ChainPRO_500390155032-314
Disulfide bond68↔114
Disulfide bond133↔157

Keywords

Interaction

Protein-protein interaction databases

Family & Domains

Features

Showing features for domain.

TypeIDPosition(s)Description
Domain53-169FZ
Domain186-306NTR

Sequence similarities

Belongs to the secreted frizzled-related protein (sFRP) family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    314
  • Mass (Da)
    35,568
  • Last updated
    2013-01-09 v1
  • Checksum
    7B7B904618E07042
MGRVQSSGGPSWRGAGTLLVLAAGLLACSNANEYDYVSFQSDIGSYQSGRFYTKPPQCVAIPADLRLCHSVGYDKMVLPNLLDHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDQFPQDDVCIAMTTPNATEASKPQGTAVCPPCDNEMKSDAIIEHLCASEFAFKMKIKEVKKENGDKKIVPKKKKPLKLGTIKRKDLKKLVLYLKNGADCPCHQLDNLSNHFLIMGRKVKTQYLLMAIHKWDKKNKEFKKFMKKMKTLECPTFQSLFK

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
AGCU01020670
EMBL· GenBank· DDBJ
-Genomic DNA No translation available.
AGCU01020671
EMBL· GenBank· DDBJ
-Genomic DNA No translation available.

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp