K5VPV0 · K5VPV0_AGABU
- ProteinOxidized purine nucleoside triphosphate hydrolase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids195 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool. Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy-dATP) into 2-oxo-dAMP. Has also a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP. Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A:T to C:G and G:C to T:A. Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA. Through this antimutagenic activity protects cells from oxidative stress.
Catalytic activity
- 2-oxo-ATP + H2O = 2-oxo-AMP + diphosphate + H+This reaction proceeds in the forward direction.
- 8-oxo-dATP + H2O = 8-oxo-dAMP + diphosphate + H+This reaction proceeds in the forward direction.
- 8-oxo-dGTP + H2O = 8-oxo-dGMP + diphosphate + H+This reaction proceeds in the forward direction.
- N6-methyl-ATP + H2O = N6-methyl-AMP + diphosphate + H+This reaction proceeds in the forward direction.
- N6-methyl-dATP + H2O = N6-methyl-dAMP + diphosphate + H+This reaction proceeds in the forward direction.
- O6-methyl-dGTP + H2O = O6-methyl-dGMP + diphosphate + H+This reaction proceeds in the forward direction.
Cofactor
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity | |
Molecular Function | metal ion binding | |
Biological Process | DNA protection |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOxidized purine nucleoside triphosphate hydrolase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Basidiomycota > Agaricomycotina > Agaricomycetes > Agaricomycetidae > Agaricales > Agaricineae > Agaricaceae > Agaricus
Accessions
- Primary accessionK5VPV0
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 30-159 | Nudix hydrolase | ||||
Sequence: PIKHYTVAHILQDDKVLLGYKKRGFGQGMYNGFGGKVEPNETPLQAAVRELEEEAGIKAPLRHIGVLIFIVAGAEKAFHIDIYYAEEFEGTVMDNRTEEMRPEWFSLSPSDGPGELPPIPWDKMWDTDRY |
Sequence similarities
Belongs to the Nudix hydrolase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length195
- Mass (Da)22,339
- Last updated2013-01-09 v1
- ChecksumEF81423DE6E5041F
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JH971402 EMBL· GenBank· DDBJ | EKM76499.1 EMBL· GenBank· DDBJ | Genomic DNA |