K3VFR5 · FDB19_FUSPC
- ProteinSolute carrier protein FPSE_08119
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids296 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Solute carrier protein; part of the Fusarium detoxification of benzoxazolinone cluster involved in the degradation of benzoxazolinones produced by the host plant (PubMed:25727347, PubMed:26828593).
Maize, wheat, and rye produce the 2 benzoxazinone phytoanticipins 2,4-dihy-droxy-7-methoxy-1,4-benzoxazin-3-one (DIMBOA) and 2,4-dihydroxy-1,4-benzoxazin-3-one (DIBOA) that, due to their inherent instability once released, spontaneously degrade to the more stable corresponding benzoxazolinones, 6-methoxy-2-benzoxazolinone (MBOA) and 2-benzoxazolinone (BOA), respectively (By similarity).
Maize, wheat, and rye produce the 2 benzoxazinone phytoanticipins 2,4-dihy-droxy-7-methoxy-1,4-benzoxazin-3-one (DIMBOA) and 2,4-dihydroxy-1,4-benzoxazin-3-one (DIBOA) that, due to their inherent instability once released, spontaneously degrade to the more stable corresponding benzoxazolinones, 6-methoxy-2-benzoxazolinone (MBOA) and 2-benzoxazolinone (BOA), respectively (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Molecular Function | transmembrane transporter activity |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSolute carrier protein FPSE_08119
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Hypocreomycetidae > Hypocreales > Nectriaceae > Fusarium
Accessions
- Primary accessionK3VFR5
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 12-32 | Helical | ||||
Sequence: GLAALQTALPFIVGCGSGMVA | ||||||
Transmembrane | 122-142 | Helical | ||||
Sequence: AGVGAGALAAVVGNPTEVILI | ||||||
Transmembrane | 219-239 | Helical | ||||
Sequence: AVAAGIAGCLGALISQPFDFV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000454606 | 1-296 | Solute carrier protein FPSE_08119 | |||
Sequence: MTDAEVIPLTKGLAALQTALPFIVGCGSGMVATTCVQPIDTIKVRLQLADRSVLRVTTWSIARDLMVEGGILNMYQGLSAAIMRSLVYGTMRLGLFSTFEKELARRARERGTTLSFGERSLAGVGAGALAAVVGNPTEVILIRMQTDGLKPLSQQARYSSAVDALRRIASHEGVLALWKGAGPTLIRAMSINFGQLTSFSEAKNQLQEHTSLSPPVRTAVAAGIAGCLGALISQPFDFVKTRLQNQVKTSPTVGLGSGELLYKGTFDCLFKVIHKEGLFRLYRDILPYFMRIGPHS |
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 16-102 | Solcar 1 | ||||
Sequence: LQTALPFIVGCGSGMVATTCVQPIDTIKVRLQLADRSVLRVTTWSIARDLMVEGGILNMYQGLSAAIMRSLVYGTMRLGLFSTFEKE | ||||||
Repeat | 114-205 | Solcar 2 | ||||
Sequence: LSFGERSLAGVGAGALAAVVGNPTEVILIRMQTDGLKPLSQQARYSSAVDALRRIASHEGVLALWKGAGPTLIRAMSINFGQLTSFSEAKNQ | ||||||
Repeat | 213-296 | Solcar 3 | ||||
Sequence: SPPVRTAVAAGIAGCLGALISQPFDFVKTRLQNQVKTSPTVGLGSGELLYKGTFDCLFKVIHKEGLFRLYRDILPYFMRIGPHS |
Sequence similarities
Belongs to the mitochondrial carrier (TC 2.A.29) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length296
- Mass (Da)31,915
- Last updated2012-11-28 v1
- ChecksumFA9B0FC343C79BD1
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AFNW01000283 EMBL· GenBank· DDBJ | EKJ71673.1 EMBL· GenBank· DDBJ | Genomic DNA |