K0P2S0 · IF4E1_ARAHY
- ProteinEukaryotic translation initiation factor 4E-1
- GeneeIF4E
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids231 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome (By similarity).
Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures (By similarity).
Key component of recessive resistance to potyviruses such as peanut stripe virus (PStV) (PubMed:28344571).
Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures (By similarity).
Key component of recessive resistance to potyviruses such as peanut stripe virus (PStV) (PubMed:28344571).
(Microbial infection) Susceptibility host factor required for viral infection by recruiting viral RNAs to the host ribosomal complex via an interaction with viral genome-linked protein (VPg).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 74-79 | N7-methylguanosine 5'-triphosphate group (UniProtKB | ChEBI); m7GTP residue in mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: KQAAWG | ||||||
Binding site | 106 | N7-methylguanosine 5'-triphosphate group (UniProtKB | ChEBI); m7GTP residue in mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 124-125 | N7-methylguanosine 5'-triphosphate group (UniProtKB | ChEBI); m7GTP residue in mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: WE | ||||||
Binding site | 174-179 | N7-methylguanosine 5'-triphosphate group (UniProtKB | ChEBI); m7GTP residue in mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: RNRQEK | ||||||
Binding site | 219-223 | N7-methylguanosine 5'-triphosphate group (UniProtKB | ChEBI); m7GTP residue in mRNA cap of mRNA (UniProtKB | ChEBI) | ||||
Sequence: KKHDR |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | eukaryotic translation initiation factor 4F complex | |
Cellular Component | nucleus | |
Molecular Function | RNA 7-methylguanosine cap binding | |
Molecular Function | translation initiation factor activity | |
Biological Process | defense response to virus |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameEukaryotic translation initiation factor 4E-1
- Short namesPeaeIF4E ; eIF-4E-1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > dalbergioids sensu lato > Dalbergieae > Pterocarpus clade > Arachis
Accessions
- Primary accessionK0P2S0
- Secondary accessions
Proteomes
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000454053 | 1-231 | Eukaryotic translation initiation factor 4E-1 | |||
Sequence: MVVEDTQKSSITDDQITANPNNENEDLEEGEILDDDDSSATSRPPSSSGALARNPHPLENSWTFWFDNPSAKSKQAAWGSSIRPIYTFATVEEFWSIYNNIHHPSKLAVGADFHCFKHKIEPKWEDPICANGGKWTMTFPRGKSDTSWLYTLLGMIGEQFDHGDEICGAVVNVRNRQEKIALWTKNAANEAAQVSIGKQWKEFLDYNDTIGFIFHEDAKKHDRAAKNKYVI | ||||||
Disulfide bond | 129↔167 | |||||
Sequence: CANGGKWTMTFPRGKSDTSWLYTLLGMIGEQFDHGDEIC |
Post-translational modification
According to the redox status, the Cys-129-Cys-167 disulfide bridge may have a role in regulating protein function by affecting its ability to bind capped mRNA.
Keywords
- PTM
Expression
Tissue specificity
Expressed ubiquitously with highest levels in young leaves and roots, and lowest levels in flowers.
Interaction
Subunit
EIF4F is a multi-subunit complex, the composition of which varies with external and internal environmental conditions (By similarity).
It is composed of at least EIF4A, EIF4E and EIF4G (By similarity).
EIF4E is also known to interact with other partners (By similarity).
In higher plants two isoforms of EIF4F have been identified, named isoform EIF4F and isoform EIF(iso)4F (By similarity).
Isoform EIF4F has subunits p220 and p26, whereas isoform EIF(iso)4F has subunits p82 and p28 (By similarity).
It is composed of at least EIF4A, EIF4E and EIF4G (By similarity).
EIF4E is also known to interact with other partners (By similarity).
In higher plants two isoforms of EIF4F have been identified, named isoform EIF4F and isoform EIF(iso)4F (By similarity).
Isoform EIF4F has subunits p220 and p26, whereas isoform EIF(iso)4F has subunits p82 and p28 (By similarity).
(Microbial infection) Interacts with potyvirus peanut stripe virus (PStV) helper component proteinase (HC-Pro) in the cytoplasm and with PStV viral genome-linked protein (VPg) in the nucleus; these interactions are possible in susceptible hosts but impaired in resistant plants.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-23 | Polar residues | ||||
Sequence: MVVEDTQKSSITDDQITANPNNE | ||||||
Region | 1-55 | Disordered | ||||
Sequence: MVVEDTQKSSITDDQITANPNNENEDLEEGEILDDDDSSATSRPPSSSGALARNP | ||||||
Region | 56-59 | EIF4G-binding | ||||
Sequence: HPLE | ||||||
Region | 66-102 | EIF4G-binding | ||||
Sequence: FDNPSAKSKQAAWGSSIRPIYTFATVEEFWSIYNNIH | ||||||
Region | 150-159 | EIF4G-binding | ||||
Sequence: YTLLGMIGEQ |
Sequence similarities
Belongs to the eukaryotic initiation factor 4E family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length231
- Mass (Da)26,138
- Last updated2012-11-28 v1
- Checksum06807AC9C93FC132
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-23 | Polar residues | ||||
Sequence: MVVEDTQKSSITDDQITANPNNE |
Keywords
- Technical term