K0E4A2 · K0E4A2_SLCV
- ProteinNuclear shuttle protein
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids250 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Binds to the genomic viral ssDNA, shuttles it into and out of the cell nucleus. Begomoviruses use 2 proteins to transport their DNA from cell to cell. The nuclear shuttle protein (NSP) shuttles it between nucleus and cytoplasm and the movement protein (MP) probably transports the DNA-NSP complex to the cell periphery and facilitates movement across the cell wall.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | host cell | |
Cellular Component | host cell cytoplasm | |
Cellular Component | host cell nucleus | |
Cellular Component | host cell plasma membrane | |
Cellular Component | membrane | |
Cellular Component | viral capsid | |
Molecular Function | single-stranded DNA binding | |
Molecular Function | structural molecule activity | |
Biological Process | DNA transport | |
Biological Process | transport of virus in host, cell to cell |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNuclear shuttle protein
- Short namesNSP
Organism names
- Organism
- Strain
- Taxonomic lineageViruses > Monodnaviria > Shotokuvirae > Cressdnaviricota > Repensiviricetes > Geplafuvirales > Geminiviridae > Begomovirus
- Virus hosts
Accessions
- Primary accessionK0E4A2
Subcellular Location
UniProt Annotation
GO Annotation
Host cell membrane ; Peripheral membrane protein
Keywords
- Cellular component
Interaction
Subunit
Binds to single-stranded and double-stranded viral DNA. Interacts with the host nuclear shuttle interacting (NSI) protein. This interaction may allow NSP to recruit NSI monomers to the viral genome and thus regulate nuclear export of viral genome by NSP.
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-31 | Disordered | ||||
Sequence: MYSTSNRRGRSQTQRGSHVRRTGVKRSYGAA |
Sequence similarities
Belongs to the begomovirus nuclear shuttle protein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length250
- Mass (Da)28,452
- Last updated2012-11-28 v1
- Checksum04052F4688561C6D