J9V7R2 · J9V7R2_NEOYE
- ProteinFerritin
- GenePyFer
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids264 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.
Catalytic activity
- 4 Fe2+ + O2 + 4 H+ = 4 Fe3+ + 2 H2O
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | ferric iron binding | |
Molecular Function | ferrous iron binding | |
Molecular Function | ferroxidase activity | |
Biological Process | intracellular sequestering of iron ion | |
Biological Process | iron ion transport |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFerritin
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Rhodophyta > Bangiophyceae > Bangiales > Bangiaceae > Neopyropia
Accessions
- Primary accessionJ9V7R2
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 91-244 | Ferritin-like diiron | ||||
Sequence: VGFSQACQDAVNNQIQVEYTASYAYHAMFAYFNRDTVALPGFAKYFEEQSLEERTHADEFMRYMNKRGGQVVLKPLAVPSMSFNNTDGTSDAVYAMDLHLQLEKFVWAKLEEVAAAANADNDLSLADLIDDYVQEQVQAVKKAADMVAQLKRVG |
Sequence similarities
Belongs to the ferritin family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length264
- Mass (Da)28,135
- Last updated2012-11-28 v1
- Checksum67604609A0A8C1C5