J3JUE9 · J3JUE9_DENPD
- ProteinGMP reductase
- Gene109536346
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids345 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides.
Catalytic activity
- IMP + NADP+ + NH4+ = GMP + 2 H+ + NADPH
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 26-27 | NADP+ (UniProtKB | ChEBI); ligand shared between two neighboring subunits | ||||
Sequence: SR | ||||||
Binding site | 78 | NADP+ (UniProtKB | ChEBI); ligand shared between two neighboring subunits; in other chain | ||||
Sequence: K | ||||||
Binding site | 129-131 | NADP+ (UniProtKB | ChEBI); ligand shared between two neighboring subunits; in other chain | ||||
Sequence: DVA | ||||||
Binding site | 180-181 | NADP+ (UniProtKB | ChEBI); ligand shared between two neighboring subunits; in other chain | ||||
Sequence: IG | ||||||
Binding site | 181 | K+ (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 183 | K+ (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Active site | 186 | Thioimidate intermediate | ||||
Sequence: C | ||||||
Binding site | 186 | K+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Active site | 188 | Proton donor/acceptor | ||||
Sequence: T | ||||||
Binding site | 189 | K+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 219-221 | GMP (UniProtKB | ChEBI) | ||||
Sequence: DGG | ||||||
Binding site | 242-243 | GMP (UniProtKB | ChEBI) | ||||
Sequence: GG | ||||||
Binding site | 268-270 | GMP (UniProtKB | ChEBI) | ||||
Sequence: GMS | ||||||
Binding site | 269 | NADP+ (UniProtKB | ChEBI); ligand shared between two neighboring subunits; in other chain | ||||
Sequence: M | ||||||
Binding site | 285-286 | NADP+ (UniProtKB | ChEBI); ligand shared between two neighboring subunits; in other chain | ||||
Sequence: YR | ||||||
Binding site | 314-317 | NADP+ (UniProtKB | ChEBI); ligand shared between two neighboring subunits | ||||
Sequence: SACT |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | GMP reductase complex | |
Molecular Function | GMP reductase activity | |
Molecular Function | metal ion binding | |
Biological Process | purine nucleobase metabolic process | |
Biological Process | purine nucleotide metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGMP reductase
- EC number
- Short namesGMPR
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Coleoptera > Polyphaga > Cucujiformia > Curculionidae > Scolytinae > Dendroctonus
Accessions
- Primary accessionJ3JUE9
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Interaction
Subunit
Homotetramer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 10-339 | IMP dehydrogenase/GMP reductase | ||||
Sequence: LDFKDVLLRPKRSTLRSRSDVNLHRHITFRNSKQDYNGIPVMASNMDTVGTFEMAKALSKHGLFTCIHKYYSAEDWKLFASDNPDVISNVAASSGIAQNDYSRLVEILAAVPAIKFVCLDVANGYTQFFVDYVRKVRAAFPTHTIIAGNVVTGEMVEELILSGADIVKVGIGPGSVCTTRMKTGVGYPQLSAVIECADAAHGLQGHIIADGGCTCPGDVAKAFGAGADFVMAGGMFAGHDQCGGEVIEKNGKKFKLFYGMSSCTAMKKYAGGVAEYRSSEGKTVEIPYKGDVEETTLDILGGLRSACTYTGAAKLKELPRRATFVRCTQQ |
Sequence similarities
Belongs to the IMPDH/GMPR family. GuaC type 1 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length345
- Mass (Da)37,257
- Last updated2012-10-03 v1
- ChecksumF0BFC586BE166C8B
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
APGK01035338 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
APGK01035339 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BT126862 EMBL· GenBank· DDBJ | AEE61824.1 EMBL· GenBank· DDBJ | mRNA | ||
KB740923 EMBL· GenBank· DDBJ | ENN78280.1 EMBL· GenBank· DDBJ | Genomic DNA |