I6VHS4 · I6VHS4_9LAMI
- ProteinAdenosine kinase
- GeneADK
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives.
Catalytic activity
- adenosine + ATP = ADP + AMP + H+
Cofactor
Pathway
Purine metabolism; AMP biosynthesis via salvage pathway; AMP from adenosine: step 1/1.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Molecular Function | adenosine kinase activity | |
Molecular Function | ATP binding | |
Biological Process | AMP salvage | |
Biological Process | purine nucleobase metabolic process | |
Biological Process | purine ribonucleoside salvage |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAdenosine kinase
- EC number
- Short namesAK
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Lamiales > Lamiaceae > Nepetoideae > Mentheae > Micromeria
Accessions
- Primary accessionI6VHS4
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-83 | Carbohydrate kinase PfkB | ||||
Sequence: IDYLFGNETEARTFSKVHGWETENVEEIALKFSQLPKASGTHKRMTVITQGADPVVVAEDGKVKTFPVTLLPKEKXVDTNGA |
Sequence similarities
Belongs to the carbohydrate kinase PfkB family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length83
- Mass (Da)9,176
- Last updated2012-10-03 v1
- Checksum6320EF2FDC93CBCC
Features
Showing features for non-terminal residue, sequence uncertainty.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: F | ||||||
Sequence uncertainty | 77 | I or L | ||||
Sequence: X | ||||||
Non-terminal residue | 83 | |||||
Sequence: A |