I6MCN2 · I6MCN2_CARTI
- ProteinPlastid omega-3 desaturase FAD7/8
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids440 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Pathway
Lipid metabolism.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast envelope | |
Cellular Component | membrane | |
Molecular Function | omega-3 fatty acid desaturase activity | |
Molecular Function | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | |
Biological Process | unsaturated fatty acid biosynthetic process |
Names & Taxonomy
Protein names
- Submitted names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Viridiplantae > Streptophyta > Streptophytina > Embryophyta > Tracheophyta > Euphyllophyta > Spermatophyta > Magnoliopsida (flowering plants) > Mesangiospermae > eudicotyledons > Gunneridae > Pentapetalae > asterids > campanulids > Asterales > Asteraceae > Carduoideae > Cardueae > Centaureinae > Carthamus
Accessions
- Primary accessionI6MCN2
Subcellular Location
UniProt Annotation
GO Annotation
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 121-139 | Helical | ||||
Sequence: YVVRDVVVVFGLAAVAAYF |
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-134 | Fatty acid desaturase N-terminal | ||||
Sequence: MANLVLSECGLRPLPTRLYPNPTTRTRTTTSTCSFPNSISIAPKKIFKPDSLVARGQRWPVKVTAPVGIQFVDEDEKRVNGVKEREGEFNPGAPPPFTLGDIRAAIPKHCWVKDPWKSMSYVVRDVVVVFGLAA | ||||||
Domain | 145-397 | Fatty acid desaturase | ||||
Sequence: WPLYWFAQGTMFWALFVLGHDCGHGSFSNNAKLNSVVGHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPLSEKIYRSLDTATRMLRFTLPFPMLAYPFYLWGRSPGKKGSHFHPNSDLFLPNEKKDVITSTVCWTAMAALLVGLSFVMGPLQVLKLYGIPYWGFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWINNIRHDIGTHVIHHLFPQIPHYNLIEATEAAKPVLGKYYR |
Sequence similarities
Belongs to the fatty acid desaturase type 1 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length440
- Mass (Da)50,350
- Last updated2012-10-03 v1
- ChecksumE16EDCC18E1A6D9B