I3SAV1 · GLB32_LOTJA
- ProteinGroup 2 truncated hemoglobin 3-2
- GeneGLB3-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids168 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Hemoglobin-like protein that exhibits an unusual concentration-independent binding of O2 and CO (By similarity).
Required for general plant development and during nodulation (PubMed:34387337).
May promote shoot organogenesis from root explants (By similarity).
Required for general plant development and during nodulation (PubMed:34387337).
May promote shoot organogenesis from root explants (By similarity).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | heme binding | |
Molecular Function | metal ion binding | |
Molecular Function | oxygen binding | |
Molecular Function | oxygen carrier activity | |
Biological Process | nodulation |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameGroup 2 truncated hemoglobin 3-2
- Short namesLjGlb3-2
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > Hologalegina > robinioid clade > Loteae > Lotus
Accessions
- Primary accessionI3SAV1
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000460304 | 1-168 | Group 2 truncated hemoglobin 3-2 | |||
Sequence: MQSLQHKASEWSGVPSDEAFAIDDTNRFLKLGLQTFINLSTNFYNRVYDDDEEWFRSIFADSEKQNAIQNQYEFFVQRMGGPPLFSQRRGHPALIGRHRPFPVTHEAAERWLHHMQQALDSTPDIDDDSKIKMQNFFRHTAYFLVAGNELKKQNEQMPCKHAAGSDNS |
Expression
Tissue specificity
Equally expressed in all organs, including root nodules, leaves, roots, stems, flowers and fruits.
Induction
Repressed by cytokinins (CK, an equimolar mixture of kinetin and 6-benzyl-aminopurine) in roots.
Developmental stage
Interaction
Subunit
Homodimer when ferric.
Structure
Family & Domains
Sequence similarities
Belongs to the truncated hemoglobin family. Group II subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length168
- Mass (Da)19,522
- Last updated2012-09-05 v1
- ChecksumD68B22689B4EC341