I3PA93 · I3PA93_CAJCA
- ProteinUrease
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids838 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
Catalytic activity
- 2 H+ + H2O + urea = CO2 + 2 NH4+
Cofactor
Note: Binds 2 nickel ions per subunit.
Pathway
Nitrogen metabolism; urea degradation; CO2 and NH3 from urea (urease route): step 1/1.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 29 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 406 | Ni2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 408 | Ni2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 489 | Ni2+ 2 (UniProtKB | ChEBI); via carbamate group | ||||
Sequence: K | ||||||
Binding site | 489 | Ni2+ 1 (UniProtKB | ChEBI); via carbamate group | ||||
Sequence: K | ||||||
Binding site | 491 | substrate | ||||
Sequence: H | ||||||
Binding site | 518 | Ni2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 544 | Ni2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Active site | 592 | Proton donor | ||||
Sequence: H | ||||||
Binding site | 632 | Ni2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | urease complex | |
Molecular Function | nickel cation binding | |
Molecular Function | urease activity | |
Biological Process | urea catabolic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameUrease
- EC number
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > indigoferoid/millettioid clade > Phaseoleae > Cajanus
Accessions
- Primary accessionI3PA93
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 489 | N6-carboxylysine | ||||
Sequence: K |
Post-translational modification
Carbamylation allows a single lysine to coordinate two nickel ions.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 401-838 | Urease | ||||
Sequence: GAIDCHVHFICPQLVDDAVTSGITTLVGGGTGPAEGTRATTCTPAPIQMKFMLQSTDDMPLNFGFTGKGNCAKPDELHEIIKAGAMGLKLHEDWGTTPAAIDSCLTIAEQYDIQVNIHTDTLNESGFVEHTIAAFKGRTIHTYHSEGAGGGHAPDIIKVCGEKNVLPSSTNPTRPYTSNTIDEHVDMLMVCHHLKRNIPEDVAFSESRIRAETIAAEDILHDMGAISIISSDSQAMGRIGEVISRTWQTADKMKSQRGPLQPGEENDNLRIKRYVAKYTINPAIANGFSQYIGSVEVGKLADLVLWKPSFFGAKPEMVIKGGEVAYANMGDPNASIPTPEPVIMRPMFGAFGKAGSAHSIAFVSKAALDNGVKASYGLNKRVEAVENVRKLTKLDGKLNDALPEITVEPESYAVTADGVVLTCAAATTVPLSRNYFIF |
Family and domain databases
Sequence
- Sequence statusComplete
- Length838
- Mass (Da)90,023
- Last updated2012-09-05 v1
- ChecksumC81F600890DB7734
Keywords
- Technical term