I1S2J3 · FGM9_GIBZE
- ProteinShort chain dehydrogenase FGM9
- GeneFGM9
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids341 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Short chain dehydrogenase; part of the Fg3_54/C64 gene cluster that mediates the biosynthesis of the octapeptide fusaoctaxin A, a virulence factor that is required for cell-to-cell invasiveness of plant host (PubMed:30804501).
The 2 nonribosomal peptide synthetases NRPS9 and NRPS5 form an assembly line which likely utilizes GABA as a starter unit (loaded on the unique module M1 of NRPS9) and sequentially incorporates seven extender units composed of the residues L-Ala, L-allo-Ile, L-Ser, L-Val, L-Ser, L-Leu and L-Leu, respectively (PubMed:30804501, PubMed:31100892).
During the process, each of the residues that are tethered on modules M3-M7 of NRPS5 containing an E domain can undergo an epimerization reaction to produce a D-configuration before the transpeptidation reaction occurs (PubMed:30804501, PubMed:31100892).
The elongation of the peptidyl chain might be terminated by module M8-mediated L-Leu incorporation, followed by R domain-catalyzed 4 electron reduction to release the resulting octapeptide from the assembly line as an alcohol (PubMed:30804501, PubMed:31100892).
Fusaoctaxin A is cleaved by the cluster specific ABC transporter FGM5 to the pentapeptide fusapentaxin A and the tripeptide fusatrixin A (PubMed:31100892).
The other enzymes from the cluster, FGM1, FGM2, FGM3 and FGM9 seem not to be involved in the biosynthesis of fusaoctaxin A and their functions have still to be determined (Probable)
The 2 nonribosomal peptide synthetases NRPS9 and NRPS5 form an assembly line which likely utilizes GABA as a starter unit (loaded on the unique module M1 of NRPS9) and sequentially incorporates seven extender units composed of the residues L-Ala, L-allo-Ile, L-Ser, L-Val, L-Ser, L-Leu and L-Leu, respectively (PubMed:30804501, PubMed:31100892).
During the process, each of the residues that are tethered on modules M3-M7 of NRPS5 containing an E domain can undergo an epimerization reaction to produce a D-configuration before the transpeptidation reaction occurs (PubMed:30804501, PubMed:31100892).
The elongation of the peptidyl chain might be terminated by module M8-mediated L-Leu incorporation, followed by R domain-catalyzed 4 electron reduction to release the resulting octapeptide from the assembly line as an alcohol (PubMed:30804501, PubMed:31100892).
Fusaoctaxin A is cleaved by the cluster specific ABC transporter FGM5 to the pentapeptide fusapentaxin A and the tripeptide fusatrixin A (PubMed:31100892).
The other enzymes from the cluster, FGM1, FGM2, FGM3 and FGM9 seem not to be involved in the biosynthesis of fusaoctaxin A and their functions have still to be determined (Probable)
Pathway
Secondary metabolite biosynthesis.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 38 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 63 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 88 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 114 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Active site | 167 | Proton donor | ||||
Sequence: S | ||||||
Active site | 200 | Proton donor | ||||
Sequence: Y | ||||||
Binding site | 200 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Active site | 204 | Lowers pKa of active site Tyr | ||||
Sequence: K | ||||||
Binding site | 204 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: K |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | oxidoreductase activity |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameShort chain dehydrogenase FGM9
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Hypocreomycetidae > Hypocreales > Nectriaceae > Fusarium
Accessions
- Primary accessionI1S2J3
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Produces significantly smaller lesions and fewer spikelets with blight symptoms on susceptible wheat cultivars.
Miscellaneous
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000449951 | 1-341 | Short chain dehydrogenase FGM9 | |||
Sequence: MSGISFKSFVQSQYTPIPLPNHDFTGQTILITGASRGLGLEAASHFYRLNASKIILAVRDARKGPECIAFVRQYNPSSNTTVECWELDLTNVETIRQFVAKAKNLARLDAVILNAGMATMSFQAIDGMEKTLATNVTGTFLLAIGLLPALRLSGLRNNIRPRMVLVSSQGHEAAAFAERDADDIFAALNDADKTDMTDRYDTSKLIQLLAFYALKDTVDKSWPDSITFTAVDPGLCDTDLTRDIPLLIRIIHRIMKMLLARTAEVGGRCLVLGAADDEHSHGAYFKDGVIGSPPVAVTDPEGVELKNRVFSQLKSLLYSVDPQIMDACPVMESDEEAIRLN |
Expression
Induction
Expression is positively regulated by the cluster-specific transcription factor FGM4 and is induced during infection of coleoptiles of wheat seedlings (PubMed:23266949, PubMed:25333987).
The fusaoctaxin A gene cluster is silenced by H3K27 trimethylation by the histone methyltransferase KMT6 (PubMed:31100892).
The fusaoctaxin A gene cluster is silenced by H3K27 trimethylation by the histone methyltransferase KMT6 (PubMed:31100892).
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length341
- Mass (Da)37,353
- Last updated2012-06-13 v1
- Checksum2AA73F0CAD8CE701
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HG970334 EMBL· GenBank· DDBJ | CEF87006.1 EMBL· GenBank· DDBJ | Genomic DNA |