I1RET0 · CFM5_GIBZE
- ProteinEffector CFEM5
- GeneCFEM5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids161 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Suppresses host programmed cell death during infection by binding to Z.mays WAK17 isoform 2 and Z.mays LRR5, to prevent activation of Z.mays WAK17 isoform 1 and the downstream hypersensitive response.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | external side of plasma membrane | |
Cellular Component | extracellular region | |
Molecular Function | metal ion binding | |
Biological Process | effector-mediated suppression of host innate immune response |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameEffector CFEM5
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Hypocreomycetidae > Hypocreales > Nectriaceae > Fusarium
Accessions
- Primary accessionI1RET0
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MFSLTKSVLFTSIVAIAAQATTA | ||||||
Chain | PRO_5010124152 | 24-161 | Effector CFEM5 | |||
Sequence: VSSPTQTSLPGLASQVPNCVAVCLRNLHESIGCDVGDIVCLCKSKASLISKVGLCVVGSQCDFEDASSSTDIVRDMCDLVAEDPGTAVIASASKVLDAVVASATTSDIEAPTSTNAAGLVAYDVVKVVVVGAAAAIAI | ||||||
Disulfide bond | 46↔78 | |||||
Sequence: CLRNLHESIGCDVGDIVCLCKSKASLISKVGLC | ||||||
Disulfide bond | 56↔63 | |||||
Sequence: CDVGDIVC | ||||||
Disulfide bond | 65↔100 | |||||
Sequence: CKSKASLISKVGLCVVGSQCDFEDASSSTDIVRDMC |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-126 | CFEM | ||||
Sequence: VSSPTQTSLPGLASQVPNCVAVCLRNLHESIGCDVGDIVCLCKSKASLISKVGLCVVGSQCDFEDASSSTDIVRDMCDLVAEDPGTAVIASASKVLDAVVASA |
Domain
The CFEM domain mediates interactions with host proteins.
Sequence similarities
Belongs to the RBT5 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length161
- Mass (Da)16,109
- Last updated2012-06-13 v1
- ChecksumB55E32C6B37F401E
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HG970332 EMBL· GenBank· DDBJ | CEF74433.1 EMBL· GenBank· DDBJ | Genomic DNA |