I1RAY1 · ATG14_GIBZE
- ProteinAutophagy-related protein 14
- GeneATG14
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids457 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Required for cytoplasm to vacuole transport (Cvt) and autophagy as a part of the autophagy-specific VPS34 PI3-kinase complex I (By similarity).
This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure (By similarity).
ATG14 mediates the specific binding of the VPS34 PI3-kinase complex I to the preautophagosomal structure (PAS) (By similarity).
Autophagy is required for proper vegetative growth, asexual/sexual reproduction, and full virulence (PubMed:28894236).
Autophagy is particularly involved in the biosynthesis of deoxynivalenol (DON), an important virulence determinant (PubMed:28894236).
This complex is essential to recruit the ATG8-phosphatidylinositol conjugate and the ATG12-ATG5 conjugate to the pre-autophagosomal structure (By similarity).
ATG14 mediates the specific binding of the VPS34 PI3-kinase complex I to the preautophagosomal structure (PAS) (By similarity).
Autophagy is required for proper vegetative growth, asexual/sexual reproduction, and full virulence (PubMed:28894236).
Autophagy is particularly involved in the biosynthesis of deoxynivalenol (DON), an important virulence determinant (PubMed:28894236).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endosome | |
Cellular Component | lytic vacuole | |
Cellular Component | phagophore assembly site membrane | |
Cellular Component | protein-containing complex | |
Cellular Component | vacuolar membrane | |
Molecular Function | SNARE binding | |
Biological Process | autophagy | |
Biological Process | protein transport | |
Biological Process | SNARE complex assembly |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAutophagy-related protein 14
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Hypocreomycetidae > Hypocreales > Nectriaceae > Fusarium
Accessions
- Primary accessionI1RAY1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Preautophagosomal structure membrane ; Peripheral membrane protein
Vacuole membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000443910 | 1-457 | Autophagy-related protein 14 | |||
Sequence: MDCDICHRSHDAKRLPFLCTVDARAALYDGRIENVMALIENEDLQKQISDLLDETNAPTKDRKDALQAQQRTAEDRTTQILAAADKLRNDIKAAKEEIQTRRAALSRRKSDIAAVSDGLIERRVKRQKSVERETGMHKYRWTKCADELARTRSFLCIEAAQLYGLKRIKEGSPSKYEYYLGGIPVVDLTAMNSSTPEMISTSLSHICQILILVSHYLSIRLPAAITLPHRDYPRPTIFNLSASYRPGDPVFPSQASVSSPSSTTDTESQRVSRPRPLFIDKPLSQLAKEDPATFSYFIEGVTLLAYNIAWACNTQGVSIGDKALFEDMSNMGRNLYNLLINHQSAGKDPDTLKNEADGQTSRFGQYSHGTTFYHLGGAEGTEFSKTFKLPSPMKLADKLKKKLLSEAPTPDWEVLDDDAWKVEEELADGSQVNKNLLMGDKSSPRRGTSGWMRVKNR |
Interaction
Subunit
Component of the autophagy-specific VPS34 PI3-kinase complex I (By similarity).
Structure
Family & Domains
Features
Showing features for coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 31-109 | |||||
Sequence: RIENVMALIENEDLQKQISDLLDETNAPTKDRKDALQAQQRTAEDRTTQILAAADKLRNDIKAAKEEIQTRRAALSRRK | ||||||
Region | 54-73 | Disordered | ||||
Sequence: ETNAPTKDRKDALQAQQRTA | ||||||
Compositional bias | 55-70 | Basic and acidic residues | ||||
Sequence: TNAPTKDRKDALQAQQ | ||||||
Compositional bias | 252-271 | Polar residues | ||||
Sequence: PSQASVSSPSSTTDTESQRV | ||||||
Region | 252-274 | Disordered | ||||
Sequence: PSQASVSSPSSTTDTESQRVSRP | ||||||
Region | 433-457 | Disordered | ||||
Sequence: NKNLLMGDKSSPRRGTSGWMRVKNR |
Domain
Coiled-Coils at the N-terminal half are essential for autophagy (By similarity).
Sequence similarities
Belongs to the ATG14 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length457
- Mass (Da)51,224
- Last updated2012-06-13 v1
- Checksum64D35A08EEE41888
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 55-70 | Basic and acidic residues | ||||
Sequence: TNAPTKDRKDALQAQQ | ||||||
Compositional bias | 252-271 | Polar residues | ||||
Sequence: PSQASVSSPSSTTDTESQRV |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
HG970332 EMBL· GenBank· DDBJ | CEF72650.1 EMBL· GenBank· DDBJ | Genomic DNA |