I1L3T1 · 708D1_SOYBN
- ProteinUDP-glycosyltransferase 708D1
- GeneUGT708D1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids480 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
UDP-glucose-dependent glucosyltransferase catalyzing the c-glucosylation of the A ring of 2-hydroxynaringenin. Also active toward phloretin, but not toward naringenin and apigenin.
Catalytic activity
- a 3'-hydro-2'-hydroxy-beta-oxodihydrochalcone + UDP-alpha-D-glucose = a 3'-(beta-D-glucopyranosyl)-2'-hydroxy-beta-oxodihydrochalcone + H+ + UDPThis reaction proceeds in the forward direction.
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 20 | Proton acceptor | ||||
Sequence: H | ||||||
Binding site | 20 | an anthocyanidin (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Active site | 118 | Charge relay | ||||
Sequence: D | ||||||
Binding site | 141 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 354 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: V | ||||||
Binding site | 356 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 371 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 374 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: W | ||||||
Binding site | 375 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 376 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 379 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 395 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 396 | UDP-alpha-D-glucose (UniProtKB | ChEBI) | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | UDP-glucosyltransferase activity |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameUDP-glycosyltransferase 708D1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > indigoferoid/millettioid clade > Phaseoleae > Glycine > Glycine subgen. Soja
Accessions
- Primary accessionI1L3T1
Proteomes
Genome annotation databases
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 20 | Loss of C-glucosyltransferase activity, but acquisition of O-glucosyltransferase activity. | ||||
Sequence: H → A | ||||||
Mutagenesis | 85 | Loss of catalytic activity. | ||||
Sequence: D → A | ||||||
Mutagenesis | 202 | No effect on catalytic activity. | ||||
Sequence: R → A | ||||||
Mutagenesis | 292 | Loss of catalytic activity. | ||||
Sequence: R → A |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000435365 | 1-480 | UDP-glycosyltransferase 708D1 | |||
Sequence: MSSSEGVVHVAFLPSAGMGHLNPFLRLAATFIRYGCKVTLITPKPTVSLAESNLISRFCSSFPHQVTQLDLNLVSVDPTTVDTIDPFFLQFETIRRSLHLLPPILSLLSTPLSAFIYDITLITPLLSVIEKLSCPSYLYFTSSARMFSFFARVSVLSASNPGQTPSSFIGDDGVKIPGFTSPIPRSSVPPAILQASSNLFQRIMLEDSANVTKLNNGVFINSFEELEGEALAALNGGKVLEGLPPVYGVGPLMACEYEKGDEEGQKGCMSSIVKWLDEQSKGSVVYVSLGNRTETRREQIKDMALGLIECGYGFLWVVKLKRVDKEDEEGLEEVLGSELSSKVKEKGVVVKEFVDQVEILGHPSVGGFLSHGGWNSVTETVWKGVPCLSWPQHSDQKMSAEVIRMSGMGIWPEEWGWGTQDVVKGDEIAKRIKEMMSNESLRVKAGELKEAALKAAGVGGSCEVTIKRQIEEWKRNAQAN |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length480
- Mass (Da)52,515
- Last updated2012-06-13 v1
- Checksum1B30238A38231D08
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
LC003312 EMBL· GenBank· DDBJ | BAR73279.1 EMBL· GenBank· DDBJ | mRNA | ||
CM000842 EMBL· GenBank· DDBJ | KRH38854.1 EMBL· GenBank· DDBJ | Genomic DNA |