I0IUP4 · MCM9_CHICK
- ProteinDNA helicase MCM9
- GeneMCM9
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1169 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the MCM8-MCM9 complex, a complex involved in homologous recombination repair following DNA interstrand cross-links and plays a key role during gametogenesis. The MCM8-MCM9 complex probably acts as a hexameric helicase required to process aberrant forks into homologous recombination substrates and to orchestrate homologous recombination with resection, fork stabilization and fork restart.
Catalytic activity
- ATP + H2O = ADP + H+ + phosphate
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | MCM complex | |
Cellular Component | MCM8-MCM9 complex | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | helicase activity | |
Molecular Function | single-stranded DNA binding | |
Biological Process | DNA damage response | |
Biological Process | DNA duplex unwinding | |
Biological Process | double-strand break repair via homologous recombination |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA helicase MCM9
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Galloanserae > Galliformes > Phasianidae > Phasianinae > Gallus
Accessions
- Primary accessionI0IUP4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to nuclear foci and colocalizes with RAD51.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 360 | Loss of function; when associated with A-484. | ||||
Sequence: K → A | ||||||
Mutagenesis | 484 | Loss of function; when associated with A-360. | ||||
Sequence: R → A |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000419477 | 1-1169 | DNA helicase MCM9 | |||
Sequence: MALRADQVSLIGQVFESYLLQHHRDDILGILRQGDDEAHYPVLVDALTLFETNMEIGEYFNAFPSQVLPIFDGALRRAAMAVLQAATPSPELRMKPNLHARISGLPICPELTREHIPKTRDVGHFLSVTGTVIRTSLVKVLEFERSYICNKCKHVFVAKADFEQYYAFCRPSACLNEEGCNSTKFTCLSGTSSSPSSCRDYQEIKIQEQVQRLSVGSIPRCMVVVLEDDLVDSCKSGDDITVYGVVMQRWKPFHQDARCDLELVLKANYVKVNNEQLAGVTIDEEVRKEFEDFWEKHRNNPLAGRNEILASLCPQVFGLYLVKLAVAMVLAGGVQRIDATGTRIRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAVKDFGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGHYDPAESVSVNIALGSPLLSRFDLVLVLLDTKNEEWDRIISSFILQNKGCPSKSEKLWSMEKMKTYFCLIKRIQPKLSDESNLILVRYYQMQRQSDCRNAARTTIRLLESLIRLAEAHARLMFRDTVTLEDAVTVVSVMESSMQGGALLGAINALHTSFPENPMTQYRMQCELILERLELHDLLHKELQRLDRLQKETYCQLQPEETSFSTITGCLNKNTFESKQKSQSEPSDQQKINSYPQPSLPKSNCEGDKHPEALRNPTPGNNISTKRLSRLNKRSDDGSLGWFDRLEDRNTDAEETFWKTSPLPKTSPDNMALKTMSKSSCSEEGNSSVPRKEDGMRGSLRTVTLCAPLEQDKVSEISSKRTEERKCFSSEANIQDPTSASASVQESVITQRVSKSLQRLHTEKSHRFFTSTQNSEANALPSVLPVSGLLDLSSDTDSVVGDENNSASAAVKHAVISMRKRSKGQAEKEAKAVSSHEPEITDGESPPAAKLAKFSFRPRTKLDDSSEKKNAEFPLFPSENTVKPGEQPQGEQLQKDCCPPEKRKMTLTCLGRKGLEKQSIGSKGNEEQLSQALGKEMGGNALIHSDVTLDVVSPPPTEKRREGEEKLGGPSTVRVCSSTLENLSKFCFASRPDSKSEAPPTIKTDTNNKESHSPLLKVHVSNPNKRKSFALGNASKDSVVTRKSLFSIAELDDATLDFDWD |
Proteomic databases
Interaction
Subunit
Component of the MCM8-MCM9 complex, which forms a hexamer composed of MCM8 and MCM9.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 302-507 | MCM | ||||
Sequence: LAGRNEILASLCPQVFGLYLVKLAVAMVLAGGVQRIDATGTRIRGESHLLLVGDPGTGKSQFLKYAVKITPRSVLTAGIGSTSAGLTVTAVKDFGEWNLEAGALVLADGGLCCIDEFNSIKEHDRTSIHEAMEQQTISVAKAGLVCKLNTRTTILAATNPKGHYDPAESVSVNIALGSPLLSRFDLVLVLLDTKNEEWDRIISSFI | ||||||
Compositional bias | 685-709 | Polar residues | ||||
Sequence: ESKQKSQSEPSDQQKINSYPQPSLP | ||||||
Region | 685-751 | Disordered | ||||
Sequence: ESKQKSQSEPSDQQKINSYPQPSLPKSNCEGDKHPEALRNPTPGNNISTKRLSRLNKRSDDGSLGWF | ||||||
Compositional bias | 737-751 | Basic and acidic residues | ||||
Sequence: SRLNKRSDDGSLGWF | ||||||
Region | 784-804 | Disordered | ||||
Sequence: MSKSSCSEEGNSSVPRKEDGM | ||||||
Region | 926-1009 | Disordered | ||||
Sequence: MRKRSKGQAEKEAKAVSSHEPEITDGESPPAAKLAKFSFRPRTKLDDSSEKKNAEFPLFPSENTVKPGEQPQGEQLQKDCCPPE | ||||||
Compositional bias | 928-946 | Basic and acidic residues | ||||
Sequence: KRSKGQAEKEAKAVSSHEP | ||||||
Compositional bias | 964-978 | Basic and acidic residues | ||||
Sequence: FRPRTKLDDSSEKKN | ||||||
Region | 1053-1080 | Disordered | ||||
Sequence: SDVTLDVVSPPPTEKRREGEEKLGGPST | ||||||
Region | 1098-1121 | Disordered | ||||
Sequence: SRPDSKSEAPPTIKTDTNNKESHS | ||||||
Compositional bias | 1105-1121 | Polar residues | ||||
Sequence: EAPPTIKTDTNNKESHS |
Sequence similarities
Belongs to the MCM family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,169
- Mass (Da)129,682
- Last updated2012-10-03 v2
- Checksum7A7E8732F2531201
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 196 | in Ref. 1; BAM08993 | ||||
Sequence: S → T | ||||||
Sequence conflict | 675 | in Ref. 1; BAM08993 | ||||
Sequence: I → T | ||||||
Compositional bias | 685-709 | Polar residues | ||||
Sequence: ESKQKSQSEPSDQQKINSYPQPSLP | ||||||
Sequence conflict | 689 | in Ref. 1; BAM08993 | ||||
Sequence: K → Q | ||||||
Compositional bias | 737-751 | Basic and acidic residues | ||||
Sequence: SRLNKRSDDGSLGWF | ||||||
Compositional bias | 928-946 | Basic and acidic residues | ||||
Sequence: KRSKGQAEKEAKAVSSHEP | ||||||
Compositional bias | 964-978 | Basic and acidic residues | ||||
Sequence: FRPRTKLDDSSEKKN | ||||||
Sequence conflict | 1050 | in Ref. 1; BAM08993 | ||||
Sequence: L → Q | ||||||
Sequence conflict | 1064 | in Ref. 1; BAM08993 | ||||
Sequence: P → H | ||||||
Compositional bias | 1105-1121 | Polar residues | ||||
Sequence: EAPPTIKTDTNNKESHS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB689141 EMBL· GenBank· DDBJ | BAM08993.1 EMBL· GenBank· DDBJ | mRNA | ||
AADN02001969 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AADN02001970 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |