H9M5U4 · VM2_CRORU
- ProteinDisintegrin rubistatin
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Recombinant disintegrin rubistatin inhibits ADP-induced platelet aggregation. In addition, it strongly induces apoptosis, and inhibits cell migration and proliferation of the human cancer cell line SK-Mel-28.
Miscellaneous
Negative results: does not induce chromatin fragmentation (apoptosis) in T24 and HeLa cells.
The disintegrin belongs to the medium disintegrin subfamily.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | plasma membrane | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameDisintegrin rubistatin
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Lepidosauria > Squamata > Bifurcata > Unidentata > Episquamata > Toxicofera > Serpentes > Colubroidea > Viperidae > Crotalinae > Crotalus
Accessions
- Primary accessionH9M5U4
Subcellular Location
PTM/Processing
Features
Showing features for disulfide bond, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Disulfide bond | ?↔3 | |||||
Sequence: NPC | ||||||
Disulfide bond | ?↔4 | |||||
Sequence: NPCC | ||||||
Chain | PRO_0000424616 | 1-61 | Disintegrin rubistatin | |||
Sequence: NPCCDAATCKMRPGSQCAEGLCCDQCRFMKKGTVCRVSMVDRNDDTCTGLSADCPRNGLYG | ||||||
Disulfide bond | 9↔23 | |||||
Sequence: CKMRPGSQCAEGLCC | ||||||
Disulfide bond | 17↔47 | |||||
Sequence: CAEGLCCDQCRFMKKGTVCRVSMVDRNDDTC | ||||||
Disulfide bond | 22↔26 | |||||
Sequence: CCDQC | ||||||
Disulfide bond | 35↔54 | |||||
Sequence: CRVSMVDRNDDTCTGLSADC |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Interaction
Subunit
Monomer.
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-61 | Disintegrin | ||||
Sequence: NPCCDAATCKMRPGSQCAEGLCCDQCRFMKKGTVCRVSMVDRNDDTCTGLSADCPRNGLYG | ||||||
Motif | 39-41 | Cell attachment site; atypical (MVD) | ||||
Sequence: MVD |
Sequence similarities
Family and domain databases
Sequence
- Sequence statusFragment
- Length61
- Mass (Da)6,558
- Last updated2012-06-13 v1
- Checksum37B421D6B0C7C8DC
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: N |