H7C5G9 · H7C5G9_HUMAN
- ProteinSarcolemma associated protein
- GeneSLMAP
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids784 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionH7C5G9
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 760-780 | Helical | ||||
Sequence: ILQPVPAVFIGLFLAFLFWCF |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 632 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 148 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 402 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 448 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 450 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 452 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, coiled coil, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 28-85 | FHA | ||||
Sequence: IKIGRSVARCRPAQNNATFDCKVLSRNHALVWFDHKTGKFYLQDTKSSNGTFINSQRL | ||||||
Coiled coil | 172-199 | |||||
Sequence: LQEALHREQMLEQKLATLQRLLAITQEA | ||||||
Coiled coil | 233-373 | |||||
Sequence: EDSLRKELIALQEDKHNYETTAKESLRRVLQEKIEVVRKLSEVERSLSNTEDECTHLKEMNERTQEELRELANKYNGAVNEIKDLSDKLKVAEGKQEEIQQKGQAEKKELQHKIDEMEEKEQELQAKIEALQADNDFTNER | ||||||
Compositional bias | 433-464 | Basic and acidic residues | ||||
Sequence: KLSKENQTRAKESDFSDTLSPSKEKSSDDTTD | ||||||
Region | 433-473 | Disordered | ||||
Sequence: KLSKENQTRAKESDFSDTLSPSKEKSSDDTTDAQMDEQDLN | ||||||
Coiled coil | 476-524 | |||||
Sequence: LAKVSLLKALLEEERKAYRNQVEESTKQIQVLQAQLQRLHIDTENLREE | ||||||
Coiled coil | 554-754 | |||||
Sequence: ASERDTDIASLQEELKKVRAELERWRKAASEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length784
- Mass (Da)90,141
- Last updated2023-05-03 v2
- Checksum2CBD75DDAF9D0C1E
Computationally mapped potential isoform sequences
There are 25 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q14BN4 | SLMAP_HUMAN | SLMAP | 828 | ||
A0A590UJT5 | A0A590UJT5_HUMAN | SLMAP | 402 | ||
A0A590UJS6 | A0A590UJS6_HUMAN | SLMAP | 807 | ||
A0A590UJU9 | A0A590UJU9_HUMAN | SLMAP | 543 | ||
A0A590UK66 | A0A590UK66_HUMAN | SLMAP | 96 | ||
A0A590UJK3 | A0A590UJK3_HUMAN | SLMAP | 842 | ||
A0A590UJP6 | A0A590UJP6_HUMAN | SLMAP | 763 | ||
A0A590UJG7 | A0A590UJG7_HUMAN | SLMAP | 201 | ||
A0A590UJH8 | A0A590UJH8_HUMAN | SLMAP | 28 | ||
A0A590UJ91 | A0A590UJ91_HUMAN | SLMAP | 43 | ||
A0A590UJ16 | A0A590UJ16_HUMAN | SLMAP | 446 | ||
H7BZW9 | H7BZW9_HUMAN | SLMAP | 778 | ||
H7BZK0 | H7BZK0_HUMAN | SLMAP | 433 | ||
H7C5S2 | H7C5S2_HUMAN | SLMAP | 65 | ||
H7C3M8 | H7C3M8_HUMAN | SLMAP | 804 | ||
A0A5F9VB99 | A0A5F9VB99_HUMAN | SLMAP | 746 | ||
A0A994J7U9 | A0A994J7U9_HUMAN | SLMAP | 800 | ||
A0A994J7V1 | A0A994J7V1_HUMAN | SLMAP | 820 | ||
A0A994J7G6 | A0A994J7G6_HUMAN | SLMAP | 531 | ||
A0A994J5K5 | A0A994J5K5_HUMAN | SLMAP | 852 | ||
A0A994J5K8 | A0A994J5K8_HUMAN | SLMAP | 724 | ||
A0A994J4X9 | A0A994J4X9_HUMAN | SLMAP | 748 | ||
A0A994J4X6 | A0A994J4X6_HUMAN | SLMAP | 740 | ||
A0A994J562 | A0A994J562_HUMAN | SLMAP | 770 | ||
A0A994J558 | A0A994J558_HUMAN | SLMAP | 787 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 433-464 | Basic and acidic residues | ||||
Sequence: KLSKENQTRAKESDFSDTLSPSKEKSSDDTTD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC099777 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC114480 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |