H3K2X4 · H3K2X4_9EURO
- ProteinSqualene monooxygenase
- Geneerg1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids415 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, and is considered to be a rate-limiting enzyme in steroid biosynthesis.
Catalytic activity
- O2 + reduced [NADPH--hemoprotein reductase] + squalene = (S)-2,3-epoxysqualene + H+ + H2O + oxidized [NADPH--hemoprotein reductase]
Cofactor
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Molecular Function | flavin adenine dinucleotide binding | |
Molecular Function | squalene monooxygenase activity | |
Biological Process | ergosterol biosynthetic process |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSqualene monooxygenase
- EC number
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Onygenales > Arthrodermataceae > Trichophyton
Accessions
- Primary accessionH3K2X4
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Microsome membrane ; Multi-pass membrane protein
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-31 | Disordered | ||||
Sequence: MVVEAPPCPQSGNGFANGSAKPKAYRDEAER | ||||||
Domain | 40-70 | FAD dependent oxidoreductase | ||||
Sequence: DVVIIGAGIAGCALAVALGNQGRSVILLERS | ||||||
Domain | 191-404 | Squalene epoxidase | ||||
Sequence: GPLTVVADGYASTFRKEYLPIQPVAKSKFWGLELIDAKLPIPGHGHVVLGDFPPILIYQIGEHETRILIDIPDNLPSASVANGGVKGHMRNVVLPSLPECIRPSFEAALEKGGFRSMPNSFLRPVTNRIPGLMFLGDSLNMRHPLTGGGMTVAFNDVVLLRNLLSPEAVPDLSDTKLVLKQLSKFHWQRKSLISVINILAQSLYSIFAAGGKHM |
Sequence similarities
Belongs to the squalene monooxygenase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length415
- Mass (Da)45,166
- Last updated2012-04-18 v1
- ChecksumD455371447E391B4
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB690298 EMBL· GenBank· DDBJ | BAL48859.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130516 EMBL· GenBank· DDBJ | QOH97037.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130517 EMBL· GenBank· DDBJ | QOH97038.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130518 EMBL· GenBank· DDBJ | QOH97039.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130519 EMBL· GenBank· DDBJ | QOH97040.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130520 EMBL· GenBank· DDBJ | QOH97041.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130521 EMBL· GenBank· DDBJ | QOH97042.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130522 EMBL· GenBank· DDBJ | QOH97043.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130523 EMBL· GenBank· DDBJ | QOH97044.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130524 EMBL· GenBank· DDBJ | QOH97045.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130525 EMBL· GenBank· DDBJ | QOH97046.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130526 EMBL· GenBank· DDBJ | QOH97047.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT130527 EMBL· GenBank· DDBJ | QOH97048.1 EMBL· GenBank· DDBJ | Genomic DNA |