H3BSL6 · H3BSL6_HUMAN
- ProteinFA complementation group A
- GeneFANCA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids299 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Fanconi anaemia nuclear complex | |
Biological Process | interstrand cross-link repair |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionH3BSL6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 642 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 170-297 | Fanconi anaemia group A protein N-terminal | ||||
Sequence: LWKIQSSLLLEAVWHLHVQGIVSLQELLESHPDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQMFVLRGFQKNSDLRRTVEPEKMPQVTVDVLQRMLIFALDALAAGVQEESSTHKIVRC |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length299
- Mass (Da)33,200
- Last updated2022-10-12 v2
- ChecksumB646E48C851402C5
Computationally mapped potential isoform sequences
There are 30 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O15360 | FANCA_HUMAN | FANCA | 1455 | ||
H3BV66 | H3BV66_HUMAN | FANCA | 77 | ||
H3BUI1 | H3BUI1_HUMAN | FANCA | 41 | ||
H3BT32 | H3BT32_HUMAN | FANCA | 51 | ||
H3BT53 | H3BT53_HUMAN | FANCA | 835 | ||
H3BT40 | H3BT40_HUMAN | FANCA | 214 | ||
H3BSI9 | H3BSI9_HUMAN | FANCA | 210 | ||
H3BS03 | H3BS03_HUMAN | FANCA | 153 | ||
H3BSA3 | H3BSA3_HUMAN | FANCA | 195 | ||
H3BRX3 | H3BRX3_HUMAN | FANCA | 316 | ||
H3BS84 | H3BS84_HUMAN | FANCA | 182 | ||
H3BQX1 | H3BQX1_HUMAN | FANCA | 168 | ||
H3BQW7 | H3BQW7_HUMAN | FANCA | 101 | ||
H3BQU1 | H3BQU1_HUMAN | FANCA | 158 | ||
H3BQU6 | H3BQU6_HUMAN | FANCA | 114 | ||
H3BNS0 | H3BNS0_HUMAN | FANCA | 1463 | ||
H3BM41 | H3BM41_HUMAN | FANCA | 109 | ||
A0A8Q3WLP8 | A0A8Q3WLP8_HUMAN | FANCA | 193 | ||
A0A8Q3WM51 | A0A8Q3WM51_HUMAN | FANCA | 276 | ||
Q0VAP4 | Q0VAP4_HUMAN | FANCA | 265 | ||
A0A8Q3WL60 | A0A8Q3WL60_HUMAN | FANCA | 198 | ||
A0A8Q3WL48 | A0A8Q3WL48_HUMAN | FANCA | 48 | ||
A0A8Q3WL53 | A0A8Q3WL53_HUMAN | FANCA | 1420 | ||
A0A8Q3WL54 | A0A8Q3WL54_HUMAN | FANCA | 277 | ||
A0A8Q3WL82 | A0A8Q3WL82_HUMAN | FANCA | 21 | ||
A0A8Q3WL44 | A0A8Q3WL44_HUMAN | FANCA | 99 | ||
A0A8Q3SIN0 | A0A8Q3SIN0_HUMAN | FANCA | 643 | ||
A0A8Q3SID5 | A0A8Q3SID5_HUMAN | FANCA | 464 | ||
A0A8Q3SJ96 | A0A8Q3SJ96_HUMAN | FANCA | 1336 | ||
F5H8D5 | F5H8D5_HUMAN | FANCA | 302 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005360 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC005567 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC010538 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC092385 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF456225 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |