H3BRK1 · H3BRK1_HUMAN
- ProteinPoly(A)-specific ribonuclease PARN
- GenePARN
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids261 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | nucleic acid binding | |
Molecular Function | poly(A)-specific ribonuclease activity |
Names & Taxonomy
Protein names
- Recommended namePoly(A)-specific ribonuclease PARN
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionH3BRK1
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 485 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 164 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 27-95 | R3H | ||||
Sequence: KKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKEELNDAVGFSRV |
Sequence similarities
Belongs to the CAF1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length261
- Mass (Da)29,406
- Last updated2012-04-18 v1
- ChecksumE7CECC7C6AE450D8
Computationally mapped potential isoform sequences
There are 19 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O95453 | PARN_HUMAN | PARN | 639 | ||
H3BVG1 | H3BVG1_HUMAN | PARN | 65 | ||
H3BT23 | H3BT23_HUMAN | PARN | 109 | ||
A0A494BZU6 | A0A494BZU6_HUMAN | PARN | 488 | ||
A0A494BZW7 | A0A494BZW7_HUMAN | PARN | 499 | ||
A0A494C002 | A0A494C002_HUMAN | PARN | 349 | ||
A0A494C008 | A0A494C008_HUMAN | PARN | 65 | ||
A0A494C1K5 | A0A494C1K5_HUMAN | PARN | 577 | ||
A0A494C1N1 | A0A494C1N1_HUMAN | PARN | 590 | ||
A0A494C1G3 | A0A494C1G3_HUMAN | PARN | 458 | ||
A0A494C0W0 | A0A494C0W0_HUMAN | PARN | 664 | ||
A0A8V8TMN8 | A0A8V8TMN8_HUMAN | PARN | 659 | ||
A0A494C0K5 | A0A494C0K5_HUMAN | PARN | 614 | ||
A0A494C0Q2 | A0A494C0Q2_HUMAN | PARN | 585 | ||
A0A494C0Q6 | A0A494C0Q6_HUMAN | PARN | 581 | ||
A0A494C0N0 | A0A494C0N0_HUMAN | PARN | 49 | ||
A0A494C156 | A0A494C156_HUMAN | PARN | 446 | ||
A0A494C0P9 | A0A494C0P9_HUMAN | PARN | 524 | ||
F5H1Z4 | F5H1Z4_HUMAN | PARN | 207 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: X | ||||||
Non-terminal residue | 261 | |||||
Sequence: D |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC009167 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC092291 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF456163 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |