H3BMP1 · H3BMP1_HUMAN
- ProteinSPG7 matrix AAA peptidase subunit, paraplegin
- GeneSPG7
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids238 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Molecular Function | ATP binding | |
Molecular Function | ATP-dependent peptidase activity | |
Molecular Function | metalloendopeptidase activity | |
Molecular Function | zinc ion binding |
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionH3BMP1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 359 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 108-133 | Disordered | ||||
Sequence: QKNKEKDKSKGKAPEEDEEERRRRER | ||||||
Domain | 144-197 | Peptidase M41 FtsH extracellular | ||||
Sequence: TLLVIAVVMSLLNALSTSGGSISWNDFVHEMLAKGEVQRVQVVPESDVVEVYLH |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length238
- Mass (Da)26,539
- Last updated2018-06-20 v2
- Checksum1E9563A118D139AB
Computationally mapped potential isoform sequences
There are 42 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9UQ90 | SPG7_HUMAN | SPG7 | 795 | ||
J3KRF6 | J3KRF6_HUMAN | SPG7 | 357 | ||
A0A2R8Y856 | A0A2R8Y856_HUMAN | SPG7 | 107 | ||
A0A2R8Y7N2 | A0A2R8Y7N2_HUMAN | SPG7 | 456 | ||
A0A2R8Y7E2 | A0A2R8Y7E2_HUMAN | SPG7 | 617 | ||
A0A2R8Y7B8 | A0A2R8Y7B8_HUMAN | SPG7 | 681 | ||
A0A2R8Y6Z7 | A0A2R8Y6Z7_HUMAN | SPG7 | 339 | ||
A0A2R8Y726 | A0A2R8Y726_HUMAN | SPG7 | 659 | ||
A0A2R8Y729 | A0A2R8Y729_HUMAN | SPG7 | 507 | ||
A0A2R8Y6K2 | A0A2R8Y6K2_HUMAN | SPG7 | 641 | ||
A0A2R8Y3M4 | A0A2R8Y3M4_HUMAN | SPG7 | 809 | ||
A0A2R8Y6E8 | A0A2R8Y6E8_HUMAN | SPG7 | 485 | ||
A0A2R8Y617 | A0A2R8Y617_HUMAN | SPG7 | 162 | ||
A0A2R8Y632 | A0A2R8Y632_HUMAN | SPG7 | 463 | ||
A0A2R8Y4Y7 | A0A2R8Y4Y7_HUMAN | SPG7 | 751 | ||
A0A2R8Y4Z7 | A0A2R8Y4Z7_HUMAN | SPG7 | 206 | ||
A0A2R8Y530 | A0A2R8Y530_HUMAN | SPG7 | 107 | ||
A0A2R8Y4L0 | A0A2R8Y4L0_HUMAN | SPG7 | 278 | ||
A0A2R8Y4L7 | A0A2R8Y4L7_HUMAN | SPG7 | 250 | ||
A0A2R8Y4M0 | A0A2R8Y4M0_HUMAN | SPG7 | 383 | ||
A0A2R8Y4M8 | A0A2R8Y4M8_HUMAN | SPG7 | 320 | ||
A0A2R8YGZ0 | A0A2R8YGZ0_HUMAN | SPG7 | 415 | ||
A0A2R8YGV4 | A0A2R8YGV4_HUMAN | SPG7 | 258 | ||
A0A2R8YDU1 | A0A2R8YDU1_HUMAN | SPG7 | 164 | ||
A0A2R8YDW8 | A0A2R8YDW8_HUMAN | SPG7 | 81 | ||
A0A2R8YDQ1 | A0A2R8YDQ1_HUMAN | SPG7 | 758 | ||
A0A2R8YDS3 | A0A2R8YDS3_HUMAN | SPG7 | 56 | ||
A0A2R8YDM8 | A0A2R8YDM8_HUMAN | SPG7 | 128 | ||
A0A2R8YCU3 | A0A2R8YCU3_HUMAN | SPG7 | 126 | ||
A0A2R8YFW4 | A0A2R8YFW4_HUMAN | SPG7 | 780 | ||
A0A2R8YG90 | A0A2R8YG90_HUMAN | SPG7 | 27 | ||
A0A2R8YG79 | A0A2R8YG79_HUMAN | SPG7 | 358 | ||
A0A2R8YFQ9 | A0A2R8YFQ9_HUMAN | SPG7 | 208 | ||
A0A2R8YFJ7 | A0A2R8YFJ7_HUMAN | SPG7 | 511 | ||
A0A2R8YFN9 | A0A2R8YFN9_HUMAN | SPG7 | 181 | ||
A0A2R8YFF4 | A0A2R8YFF4_HUMAN | SPG7 | 421 | ||
H3BTR8 | H3BTR8_HUMAN | SPG7 | 106 | ||
A0A2R8YEH4 | A0A2R8YEH4_HUMAN | SPG7 | 493 | ||
H3BTY6 | H3BTY6_HUMAN | SPG7 | 210 | ||
H3BNE4 | H3BNE4_HUMAN | SPG7 | 70 | ||
A0A2U3TZH1 | A0A2U3TZH1_HUMAN | SPG7 | 788 | ||
A0A087X0F5 | A0A087X0F5_HUMAN | SPG7 | 114 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 238 | |||||
Sequence: L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC092123 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |