H0YDD4 · H0YDD4_HUMAN
- ProteinAcetyltransferase component of pyruvate dehydrogenase complex
- GeneDLAT
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids520 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2.
Catalytic activity
- acetyl-CoA + N6-[(R)-dihydrolipoyl]-L-lysyl-[protein] = CoA + N6-[(R)-S8-acetyldihydrolipoyl]-L-lysyl-[protein]This reaction proceeds in the forward direction.
Cofactor
Note: Binds 1 lipoyl cofactor covalently.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Cellular Component | pyruvate dehydrogenase complex | |
Molecular Function | dihydrolipoyllysine-residue acetyltransferase activity | |
Biological Process | acetyl-CoA biosynthetic process from pyruvate |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAcetyltransferase component of pyruvate dehydrogenase complex
- EC number
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionH0YDD4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 567 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 100 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 348 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 29-49 | Disordered | ||||
Sequence: PGTPRVTSRSGPAPARRNSVT | ||||||
Domain | 91-167 | Lipoyl-binding | ||||
Sequence: HQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIV | ||||||
Region | 185-221 | Disordered | ||||
Sequence: TDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATP | ||||||
Compositional bias | 187-220 | Pro residues | ||||
Sequence: LKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPAT | ||||||
Domain | 229-266 | Peripheral subunit-binding (PSBD) | ||||
Sequence: FVSPLAKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFV |
Sequence similarities
Belongs to the 2-oxoacid dehydrogenase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length520
- Mass (Da)55,718
- Last updated2021-06-02 v2
- Checksum7D0D2970CC087B66
Computationally mapped potential isoform sequences
There are 13 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P10515 | ODP2_HUMAN | DLAT | 647 | ||
A0A7P0T9N8 | A0A7P0T9N8_HUMAN | DLAT | 243 | ||
A0A7P0T997 | A0A7P0T997_HUMAN | DLAT | 636 | ||
A0A7P0TAX2 | A0A7P0TAX2_HUMAN | DLAT | 640 | ||
A0A7P0TBE2 | A0A7P0TBE2_HUMAN | DLAT | 645 | ||
A0A7P0TBK2 | A0A7P0TBK2_HUMAN | DLAT | 554 | ||
A0A7P0TA47 | A0A7P0TA47_HUMAN | DLAT | 446 | ||
A0A7P0TAG1 | A0A7P0TAG1_HUMAN | DLAT | 611 | ||
E9PKC7 | E9PKC7_HUMAN | DLAT | 65 | ||
A0A7P0Z423 | A0A7P0Z423_HUMAN | DLAT | 225 | ||
A0A7P0Z459 | A0A7P0Z459_HUMAN | DLAT | 294 | ||
A0A7P0Z4G4 | A0A7P0Z4G4_HUMAN | DLAT | 562 | ||
E9PEJ4 | E9PEJ4_HUMAN | DLAT | 542 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 187-220 | Pro residues | ||||
Sequence: LKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPAT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP000907 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |