H0YAM7 · H0YAM7_HUMAN
- ProteinSmall ribosomal subunit protein RACK1
- GeneRACK1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids247 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | ribosome | |
Molecular Function | ribosome binding | |
Molecular Function | translation regulator activity | |
Biological Process | gastrulation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein RACK1
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionH0YAM7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 138 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 64 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 68 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 183 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 184 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 186 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 8-40 | WD | ||||
Sequence: FVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWN | ||||||
Repeat | 51-94 | WD | ||||
Sequence: DESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTN | ||||||
Repeat | 95-136 | WD | ||||
Sequence: HIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYT |
Sequence similarities
Belongs to the WD repeat G protein beta family. Ribosomal protein RACK1 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length247
- Mass (Da)27,416
- Last updated2012-02-22 v1
- ChecksumC5D8B49C4318DEAF
Computationally mapped potential isoform sequences
There are 21 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P63244 | RACK1_HUMAN | RACK1 | 317 | ||
J3KPE3 | J3KPE3_HUMAN | RACK1 | 273 | ||
D6RFX4 | D6RFX4_HUMAN | RACK1 | 194 | ||
D6RFZ9 | D6RFZ9_HUMAN | RACK1 | 197 | ||
D6RF23 | D6RF23_HUMAN | RACK1 | 101 | ||
D6REE5 | D6REE5_HUMAN | RACK1 | 321 | ||
D6RHH4 | D6RHH4_HUMAN | RACK1 | 233 | ||
D6RHJ5 | D6RHJ5_HUMAN | RACK1 | 86 | ||
D6RGK8 | D6RGK8_HUMAN | RACK1 | 71 | ||
D6RBD0 | D6RBD0_HUMAN | RACK1 | 160 | ||
D6RAU2 | D6RAU2_HUMAN | RACK1 | 147 | ||
D6RAC2 | D6RAC2_HUMAN | RACK1 | 269 | ||
D6RDI0 | D6RDI0_HUMAN | RACK1 | 39 | ||
H0YAF8 | H0YAF8_HUMAN | RACK1 | 198 | ||
D6R9Z1 | D6R9Z1_HUMAN | RACK1 | 236 | ||
D6R9L0 | D6R9L0_HUMAN | RACK1 | 300 | ||
H0Y9P0 | H0Y9P0_HUMAN | RACK1 | 83 | ||
D6R909 | D6R909_HUMAN | RACK1 | 116 | ||
H0Y8W2 | H0Y8W2_HUMAN | RACK1 | 274 | ||
H0Y8R5 | H0Y8R5_HUMAN | RACK1 | 138 | ||
E9PD14 | E9PD14_HUMAN | RACK1 | 153 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: X |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC008443 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KC877161 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |