G9HPX0 · G9HPX0_SOLLC
- ProteinAuxin-responsive protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids287 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Biological Process | auxin-activated signaling pathway | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAuxin-responsive protein
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > asterids > lamiids > Solanales > Solanaceae > Solanoideae > Solaneae > Solanum > Solanum subgen. Lycopersicon
Accessions
- Primary accessionG9HPX0
Subcellular Location
Interaction
Subunit
Homodimers and heterodimers.
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-33 | Disordered | ||||
Sequence: MEGYSQKWLMQRGEEINHGNSEEKKLELRLGPP | ||||||
Compositional bias | 16-30 | Basic and acidic residues | ||||
Sequence: INHGNSEEKKLELRL | ||||||
Region | 106-126 | Disordered | ||||
Sequence: QTATVQNSAQKRTAPAPVVGW | ||||||
Domain | 168-278 | PB1 | ||||
Sequence: GLFVKINMDGIPIGRKVDLKAYDSYHKLSSAVDQLFRGLVAAQNDSSAGGNNEKKEDEEKAISGLLDGSGEYTLVYEDNEGDRMLVGDVPWHMFVSTVKRLRVLKSSELST |
Sequence similarities
Belongs to the Aux/IAA family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length287
- Mass (Da)31,926
- Last updated2012-02-22 v1
- Checksum4AC13CE4FF43A832
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 16-30 | Basic and acidic residues | ||||
Sequence: INHGNSEEKKLELRL |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
JN379449 EMBL· GenBank· DDBJ | AEX00365.1 EMBL· GenBank· DDBJ | mRNA |