G7XMT1 · CYPE5_ASPKW
- ProteinSelf-sufficient cytochrome P450 monooxygenase CYP505E5
- GeneCYP505E5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1050 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Self-sufficient cytochrome P450 monooxygenase that catalyzes the regioselective in-chain hydroxylation of alkanes, fatty alcohols, and fatty acids at the omega-7 position (PubMed:36607403).
Performs hydroxylation of C10-C16 n-alkanes and C12 and C14 fatty alcohols; and thereby enables the one step biocatalytic synthesis of rare alcohols such as 5-dodecanol and 7-tetradecanol (PubMed:36607403).
Converts 1-dodecanol into 1,5-dodecanediol as major product with very little sub-terminally hydroxylated products with the 1,4-dodecanediol and 1,6-dodecanediol more abundant (PubMed:36607403).
Converts dodecanoic acid to 5-hydroxydodecanoic acid which can be further converted into delta-dodecalactone by lactonization of the 5-hydroxy acid at low pH (PubMed:36607403).
Also gives sub-terminal hydroxylation of dodecanoic acid with 9-hydroxydodecanoic acid being the second most abundant product (PubMed:36607403).
Performs hydroxylation of C10-C16 n-alkanes and C12 and C14 fatty alcohols; and thereby enables the one step biocatalytic synthesis of rare alcohols such as 5-dodecanol and 7-tetradecanol (PubMed:36607403).
Converts 1-dodecanol into 1,5-dodecanediol as major product with very little sub-terminally hydroxylated products with the 1,4-dodecanediol and 1,6-dodecanediol more abundant (PubMed:36607403).
Converts dodecanoic acid to 5-hydroxydodecanoic acid which can be further converted into delta-dodecalactone by lactonization of the 5-hydroxy acid at low pH (PubMed:36607403).
Also gives sub-terminal hydroxylation of dodecanoic acid with 9-hydroxydodecanoic acid being the second most abundant product (PubMed:36607403).
Catalytic activity
- NADPH + 2 oxidized [cytochrome P450] = H+ + NADP+ + 2 reduced [cytochrome P450]
- dodecanoate + O2 + reduced [NADPH--hemoprotein reductase] = 5-hydroxydodecanoate + H+ + H2O + oxidized [NADPH--hemoprotein reductase]This reaction proceeds in the forward direction.
- O2 + reduced [NADPH--hemoprotein reductase] + tetradecanoate = 7-hydroxytetradecanoate + H+ + H2O + oxidized [NADPH--hemoprotein reductase]This reaction proceeds in the forward direction.
- dodecan-1-ol + O2 + reduced [NADPH--hemoprotein reductase] = 1,5-dodecanediol + H+ + H2O + oxidized [NADPH--hemoprotein reductase]This reaction proceeds in the forward direction.
- dodecan-1-ol + O2 + reduced [NADPH--hemoprotein reductase] = 1,4-dodecanediol + H+ + H2O + oxidized [NADPH--hemoprotein reductase]This reaction proceeds in the forward direction.
- dodecan-1-ol + O2 + reduced [NADPH--hemoprotein reductase] = 1,6-dodecanediol + H+ + H2O + oxidized [NADPH--hemoprotein reductase]This reaction proceeds in the forward direction.
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 FAD.
Note: Binds 1 FMN.
Features
Showing features for binding site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | aromatase activity | |
Molecular Function | flavin adenine dinucleotide binding | |
Molecular Function | FMN binding | |
Molecular Function | heme binding | |
Molecular Function | iron ion binding | |
Molecular Function | NADPH-hemoprotein reductase activity |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameSelf-sufficient cytochrome P450 monooxygenase CYP505E5
- Alternative names
Including 2 domains:
- Recommended nameCytochrome P450 monooxygenase
- EC number
- Recommended nameNADPH--cytochrome P450 reductase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Eurotiales > Aspergillaceae > Aspergillus > Aspergillus subgen. Circumdati
Accessions
- Primary accessionG7XMT1
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000459037 | 1-1050 | Self-sufficient cytochrome P450 monooxygenase CYP505E5 | |||
Sequence: MKDAERIPGPKPLPVVGNLFDIDPEHSLESIVAFAEKFGPLFQITINGEKQIFATSQALVDELCDELRFHKAVVTGLEILRLLAHDGLFTAYHGERGWGIAHRILVPAFGPLRIRNMLDDMSDVAQQLCLKWARQGGSTSINITEDFTRLTLDTIALCTMGFRLNSFYNNETMHPFVQSMLYVLREADIQANLPGIANSIRVSAQRRMHKNIEAMRTMARGIIQERRKNKNPVDDILNTLLNGRDPVTGEGMSDDSIIDNVITFLIAGHETTSGLLSFTFYFLIQHPHILKKAQEEVDETVGLAQISAQHLAELPYIDAILKESLRLMPTAPGFTVTPKKTEVLGGRWMINAGQPVNVLLPACLRDQSVFGPDADEFRPERMLAENFSKLPPNSWKPFGNGERGCIGRAFAWQEAQLVVAMILQTFDLVPDDPSYQLRIKETLTIKPDGFRIRATLRRGQTATGLSRRSMLVARDGSSEESSNHPAEARGDHAPARGQPVSFFYGSNSGTCKALAHQLASNMMSRGYTTQKLAPLDNAVDNLPRDQPVIILTTTYDGQPTDNAKKFVAWLETGNVLSLQGISYAVFGCGHHDWTQTFYRIPILIDDLMYKAGATRLAPRGAANAAVSDLFSDLEAWEETSLLPALRENFLPSNSTDFDPLNPHQIQLSLSKPRRVDLHKGLIEAKVTAVRVLTSPDTPEKRHLEFCFQGDLSLRPGDHLNILPVNPPSTVSRVLAQFNLAPDYNITVNSFNTLGLPQATPVSASELFSSYVELCQPATRNNLKSLIAATQSDTVKQELNRLYDSYEFIVRDKRVSVLDLLEQFPSISLPIAAFISMLPALRVRTYSLSMAPAFKPSHSSLTFSVINEPAWRGSGQHLGVASNYLASLTSGSIFYFSPRPAKETFHLPKDPSRTPIIMICAGSGLAPFLSFIQDRMVLKQQNKPLAKAFLFFGCRGRSLDDLYHEELSEYEAAGVVEVRRAYSKTPEFDIAKGCRYVQHRLVTEGQAILSLWAQNAIIYVCGSTSMAKGAEAVLQNMLGPLPKERYVTEIF |
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 461-495 | Disordered | ||||
Sequence: TATGLSRRSMLVARDGSSEESSNHPAEARGDHAPA | ||||||
Domain | 500-641 | Flavodoxin-like | ||||
Sequence: VSFFYGSNSGTCKALAHQLASNMMSRGYTTQKLAPLDNAVDNLPRDQPVIILTTTYDGQPTDNAKKFVAWLETGNVLSLQGISYAVFGCGHHDWTQTFYRIPILIDDLMYKAGATRLAPRGAANAAVSDLFSDLEAWEETSL | ||||||
Domain | 679-907 | FAD-binding FR-type | ||||
Sequence: KGLIEAKVTAVRVLTSPDTPEKRHLEFCFQGDLSLRPGDHLNILPVNPPSTVSRVLAQFNLAPDYNITVNSFNTLGLPQATPVSASELFSSYVELCQPATRNNLKSLIAATQSDTVKQELNRLYDSYEFIVRDKRVSVLDLLEQFPSISLPIAAFISMLPALRVRTYSLSMAPAFKPSHSSLTFSVINEPAWRGSGQHLGVASNYLASLTSGSIFYFSPRPAKETFHLP |
Sequence similarities
In the N-terminal section; belongs to the cytochrome P450 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,050
- Mass (Da)116,590
- Last updated2012-01-25 v1
- Checksum96B287877AB891C4