G5EGK1 · G5EGK1_CAEEL
- ProteinFERM domain-containing protein
- Genetln-1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids2553 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basement membrane | |
Cellular Component | cytoplasm | |
Cellular Component | cytoskeleton | |
Cellular Component | focal adhesion | |
Cellular Component | lateral plasma membrane | |
Cellular Component | M band | |
Cellular Component | plasma membrane | |
Cellular Component | ruffle | |
Cellular Component | striated muscle dense body | |
Molecular Function | actin filament binding | |
Molecular Function | integrin binding | |
Molecular Function | structural constituent of cytoskeleton | |
Biological Process | cell-cell adhesion | |
Biological Process | integrin-mediated signaling pathway | |
Biological Process | negative regulation of epidermal growth factor receptor signaling pathway | |
Biological Process | regulation of vulval development | |
Biological Process | vulval cell fate specification |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5EGK1
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 87-431 | FERM | ||||
Sequence: RLLKVRMLDGAVKTISVDESQPVSQLMMTVCNKIGISNYEEYSLVRDDILMQNGGGGGGGGGQNGGSTWNLKEKESRSKSSDRGGGGIYGTMRKKNEQKLEELRKKLHTDEELPWLDHTKTLREQGITEEETLILRRKYFFSDSNVDSRDPVQLNLLYVQCRDGILRGLHPVEKETAFQLAALQSHIQYGDFPYDKPKFHLDGRDVLPKEYAKNKENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGVTFFVVKEKLPGKNKLVPRLLGVNKESVMRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDYQDGYYSVQTTDGEKIAQLIQGYVDIILKKK | ||||||
Region | 140-181 | Disordered | ||||
Sequence: GGGGGGGGGQNGGSTWNLKEKESRSKSSDRGGGGIYGTMRKK | ||||||
Coiled coil | 1706-1733 | |||||
Sequence: ANAERQLLQQVQHIASQLEDKVDDLHNA | ||||||
Domain | 2311-2549 | I/LWEQ | ||||
Sequence: PHNHEMESAAAQAENELLGAASSIEAASAKLAELRPRQIVQENTQEIVETEFDDNIIISAKGILHAVHTLMRSASNAQRELAMQGRAAAGGTGTYQWSEGLISAARVVVASVHKLCDAANTLMKGQTTEERLISAAKQVSSSTAQLLVACNVRADPDSQANRRLQAAGQAVRNAAERLVQSAQQEMIARDDRNIAISDRLVNGIAQVMDAQEEVLRKERELGEARHKLAHLNKARYERD | ||||||
Coiled coil | 2517-2544 | |||||
Sequence: VMDAQEEVLRKERELGEARHKLAHLNKA |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,553
- Mass (Da)279,126
- Last updated2011-12-14 v1
- ChecksumF08F84883D7F5FA4
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
G4S9F5 | G4S9F5_CAEEL | tln-1 | 1890 | ||
A0A0K3AQU9 | A0A0K3AQU9_CAEEL | tln-1 | 631 | ||
W6SBK6 | W6SBK6_CAEEL | tln-1 | 1511 | ||
A0A0K3ATT6 | A0A0K3ATT6_CAEEL | tln-1 | 2188 | ||
A0A0K3AUD9 | A0A0K3AUD9_CAEEL | tln-1 | 58 | ||
Q95XN3 | Q95XN3_CAEEL | tln-1 | 996 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L46861 EMBL· GenBank· DDBJ | AAA74747.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284601 EMBL· GenBank· DDBJ | CCD67967.1 EMBL· GenBank· DDBJ | Genomic DNA |