G5EG88 · ACH23_CAEEL
- ProteinBetaine receptor acr-23
- Geneacr-23
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids545 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Betaine receptor that functions as a ligand-gated non-selective monovalent cation channel in mechanosensory neurons to maintain basal levels of locomotion. The channel is permeable to Na+ and K+ but not to Ba2+ or Ca2+ ions. Elicits current in response to betaine, very weak current in response to choline, virtually no current in response to acetylcholine and nicotine, and no current in response to glycine and GABA.
Miscellaneous
Suppresses snf-3 mutant phenotype growth defects. Elicits no current in response to the broad-spectrum antiparasitic medicine ivermectin. This channel is allosterically sensitive to monepantel, an anthelmintic of the amino-acetonitrile derivatives (AADs) class, leading to muscle paralysis upon treatment with monepantel.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | postsynapse | |
Cellular Component | synapse | |
Cellular Component | transmembrane transporter complex | |
Molecular Function | excitatory extracellular ligand-gated monoatomic ion channel activity | |
Molecular Function | transmembrane signaling receptor activity | |
Molecular Function | transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBetaine receptor acr-23
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5EG88
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 20-244 | Extracellular | ||||
Sequence: NNPDIPIQYELANNIMENYQKGLIPKVRKGSPINVTLSLQLYQIIQVNEPQQYLLLNAWAVERWVDQMLGWDPSEFDNETEIMARHDDIWLPDTTLYNSLEMDDSASKKLTHVKLTTLGKNQGAMVELLYPTIYKISCLLNLKYFPFDTQTCRMTFGSWSFDNSLIDYFPRTFTNGPIGLANFLENDAWSVLGTKVNREEKKYTCCPVNYTLLHYDVVIQRKPLY | ||||||
Transmembrane | 245-265 | Helical | ||||
Sequence: YVLNLIAPTAVITFISIIGFF | ||||||
Transmembrane | 287-307 | Helical | ||||
Sequence: EKITLGITTLLSMSIMIFMVS | ||||||
Transmembrane | 317-337 | Helical | ||||
Sequence: VPLIALFYTLMITIISVGTLA | ||||||
Topological domain | 338-512 | Cytoplasmic | ||||
Sequence: ASSVIFVQKLGSIGNPPASKTMKWTHRIAPFVLIQMPLVMKQAYAKRAKEEKHRKRMSRKNSMWTKVYHLARDHSKLMETVPDGAVKFNQISDFKNNDIGNMESPRMAESQTSETFAAPMDTSFTESLHIPELNRVASSNSIQSVLKPTEIQLTPYCTRNIVELEWDWVAAVLER | ||||||
Transmembrane | 513-533 | Helical | ||||
Sequence: VFLIFFTICFLFSAIGINLYG |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mutant worms are morphologically similar to the wild-type but exhibit mild swimming defects and are lethargic with their movement being interrupted by frequent pauses when crawling on a food-free environment (PubMed:24212673).
On the same environment, in other occasions they display decreased rates of spontaneous reversal and steering, and slightly increased average speed (PubMed:23950710).
Homozygotes are fully resistant to monepantel but heterozygotes are partially affected by the drug with reduced fertility and slightly impaired movement
On the same environment, in other occasions they display decreased rates of spontaneous reversal and steering, and slightly increased average speed (PubMed:23950710).
Homozygotes are fully resistant to monepantel but heterozygotes are partially affected by the drug with reduced fertility and slightly impaired movement
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 112 | In cb101; highly resistant to monepantel. | ||||
Sequence: D → N | ||||||
Mutagenesis | 301 | Increases sensitivity to betaine. Leads to death during larval development in most cases, with escapees reaching to adulthood but being hypercontracted and uncoordinated. | ||||
Sequence: I → N | ||||||
Mutagenesis | 311 | In ox429; mild swimming defects and lethargic movement when crawling on a food-free environment. | ||||
Sequence: P → L | ||||||
Mutagenesis | 321 | In cb103; highly resistant to monepantel. | ||||
Sequence: A → T |
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MHRIYTFLIFISQLALGLS | ||||||
Chain | PRO_0000425863 | 20-545 | Betaine receptor acr-23 | |||
Sequence: NNPDIPIQYELANNIMENYQKGLIPKVRKGSPINVTLSLQLYQIIQVNEPQQYLLLNAWAVERWVDQMLGWDPSEFDNETEIMARHDDIWLPDTTLYNSLEMDDSASKKLTHVKLTTLGKNQGAMVELLYPTIYKISCLLNLKYFPFDTQTCRMTFGSWSFDNSLIDYFPRTFTNGPIGLANFLENDAWSVLGTKVNREEKKYTCCPVNYTLLHYDVVIQRKPLYYVLNLIAPTAVITFISIIGFFTSVNPFTNFCNVSSSVHDLRQEKITLGITTLLSMSIMIFMVSDKMPSTSTCVPLIALFYTLMITIISVGTLAASSVIFVQKLGSIGNPPASKTMKWTHRIAPFVLIQMPLVMKQAYAKRAKEEKHRKRMSRKNSMWTKVYHLARDHSKLMETVPDGAVKFNQISDFKNNDIGNMESPRMAESQTSETFAAPMDTSFTESLHIPELNRVASSNSIQSVLKPTEIQLTPYCTRNIVELEWDWVAAVLERVFLIFFTICFLFSAIGINLYGWYIWYTENHFLF | ||||||
Glycosylation | 53 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 97 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 157↔171 | |||||
Sequence: CLLNLKYFPFDTQTC | ||||||
Disulfide bond | 224↔225 | Associated with receptor activation | ||||
Sequence: CC | ||||||
Glycosylation | 228 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 276 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the body wall muscles that are arranged into four longitudinal bundles, some mechanosensory neurons, the head muscles and multiple interneurons. Not expressed in motor neurons (at protein level).
Developmental stage
Not expressed in embryos and L1 stage but expressed from L2 stage to adulthood in the body wall muscles (at protein level).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length545
- Mass (Da)62,549
- Last updated2011-12-14 v1
- ChecksumE23060B59A170221
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A168H5T6 | A0A168H5T6_CAEEL | acr-23 | 534 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FO081512 EMBL· GenBank· DDBJ | CCD72123.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY519853 EMBL· GenBank· DDBJ | AAR89634.1 EMBL· GenBank· DDBJ | mRNA |