G5EFF5 · DAF12_CAEEL
- ProteinNuclear hormone receptor family member daf-12
- Genedaf-12
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids753 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Nuclear receptor which binds directly to response elements in target gene promoters (PubMed:10859169, PubMed:15314028, PubMed:15383841, PubMed:15489294, PubMed:15611047, PubMed:16626392, PubMed:19828440, PubMed:21814518, PubMed:9477318).
Activity is modulated by binding of steroid hormone ligands that include dafachronic acids (PubMed:16529801).
Regulates expression of genes involved in postembryonic development and the dauer diapause, in response to environmental cues (PubMed:10859169, PubMed:15383841, PubMed:15489294, PubMed:16626392, PubMed:19828440, PubMed:21814518, PubMed:9477318).
Inhibits the expression of let-7 family members when bound to corepressor din-1s which is an isoform of din-1 (PubMed:19828440).
Plays a role in controlling the timing of seam cell development during the larval stages (PubMed:21471153).
Has a role in the immune response to bacterial infection, via regulation of let-7 miRNAs (PubMed:23990780).
Controls expression of genes that promote the aerobic catabolism of fatty acids for reproductive growth (PubMed:25774872).
May be involved in thermotolerance (PubMed:24957743).
Activity is modulated by binding of steroid hormone ligands that include dafachronic acids (PubMed:16529801).
Regulates expression of genes involved in postembryonic development and the dauer diapause, in response to environmental cues (PubMed:10859169, PubMed:15383841, PubMed:15489294, PubMed:16626392, PubMed:19828440, PubMed:21814518, PubMed:9477318).
Inhibits the expression of let-7 family members when bound to corepressor din-1s which is an isoform of din-1 (PubMed:19828440).
Plays a role in controlling the timing of seam cell development during the larval stages (PubMed:21471153).
Has a role in the immune response to bacterial infection, via regulation of let-7 miRNAs (PubMed:23990780).
Controls expression of genes that promote the aerobic catabolism of fatty acids for reproductive growth (PubMed:25774872).
May be involved in thermotolerance (PubMed:24957743).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 115-190 | Nuclear receptor | ||||
Sequence: QKTCRVCGDHATGYNFNVITCESCKAFFRRNALRPKEFKCPYSEDCEINSVSRRFCQKCRLRKCFTVGMKKEWILN |
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNuclear hormone receptor family member daf-12
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5EFF5
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Reduced lifespan associated with accelerated aging and increased tissue deterioration (PubMed:16626392).
Defective dauer formation (PubMed:10859169, PubMed:9477318).
In the absence of cholesterol, arrest with abnormal cuticle formation (PubMed:15383841).
Increased resistance to P.aeruginosa infection possibly due to elevated expression of antimicrobial genes (PubMed:23990780).
Prevents increase in the number of muscle arm extension in a daf-2 (e1375) background (PubMed:18436204).
RNAi-mediated knockdown results in reduced lifespan, but increased resistance to bacterial infection (PubMed:23990780).
Defective dauer formation (PubMed:10859169, PubMed:9477318).
In the absence of cholesterol, arrest with abnormal cuticle formation (PubMed:15383841).
Increased resistance to P.aeruginosa infection possibly due to elevated expression of antimicrobial genes (PubMed:23990780).
Prevents increase in the number of muscle arm extension in a daf-2 (e1375) background (PubMed:18436204).
RNAi-mediated knockdown results in reduced lifespan, but increased resistance to bacterial infection (PubMed:23990780).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 121 | In sa156; no transcriptional activity in vitro. Defective dauer formation. | ||||
Sequence: C → Y | ||||||
Mutagenesis | 125 | In m420; no transcriptional activity in vitro. Defective dauer formation. | ||||
Sequence: A → V | ||||||
Mutagenesis | 137 | In m421; no transcriptional activity in vitro. Defective dauer formation. | ||||
Sequence: S → F | ||||||
Mutagenesis | 143 | In m116 and m423; no transcriptional activity in vitro. Defective dauer formation. | ||||
Sequence: R → K | ||||||
Mutagenesis | 195 | Defective nuclear localization; when associated with A-198. | ||||
Sequence: R → A | ||||||
Mutagenesis | 196 | Defective nuclear localization; when associated with A-198. | ||||
Sequence: R → A | ||||||
Mutagenesis | 196 | Small reduction in DNA binding in vitro. | ||||
Sequence: R → K | ||||||
Mutagenesis | 197 | Severely reduced DNA binding and reduced transcriptional activity in vitro. | ||||
Sequence: R → A | ||||||
Mutagenesis | 197 | In m424; reduced DNA binding affinity and transcriptional activity in vitro. Defective dauer formation. | ||||
Sequence: R → K | ||||||
Mutagenesis | 198 | Defective nuclear localization; when associated with A-195 or A-196. | ||||
Sequence: K → A | ||||||
Mutagenesis | 461 | In rh286; mild gonadal heterochrony. | ||||
Sequence: C → Y | ||||||
Mutagenesis | 562 | In m25; defective dauer formation. | ||||
Sequence: M → I | ||||||
Mutagenesis | 564 | In rh62 and rh274; dauer-constitutive phenotype with gonadal heterochrony. | ||||
Sequence: R → C | ||||||
Mutagenesis | 564 | In rh273; dauer-constitutive phenotype with gonadal heterochrony. | ||||
Sequence: R → H | ||||||
Mutagenesis | 582 | In rh193; temperature sensitive mutant. | ||||
Sequence: G → K | ||||||
Mutagenesis | 746 | In rh284; temperature sensitive mutation that prevents transcriptional activity and with gonadal heterochrony. | ||||
Sequence: P → S |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000433989 | 1-753 | Nuclear hormone receptor family member daf-12 | |||
Sequence: MGTNGGVIAEQSMEIETNENPDKVEEPVVRRKRVTRRRHRRIHSKNNCLTPPNSDDDPQMSTPDDPVIHSPPSIGAAPGMNGYHGSGVKLEESSGACGSPDDGLLDSSEESRRRQKTCRVCGDHATGYNFNVITCESCKAFFRRNALRPKEFKCPYSEDCEINSVSRRFCQKCRLRKCFTVGMKKEWILNEEQLRRRKNSRLNNTGTCNKRSQPGNQQSPQGPNQQPHLSPHHPGVAIYPPQPQRPLTINPMDNQMMHHMQANRPNAMPQLISPPGAQPYPLTSPVGSSASDSPPNRSLTMMHNGEKSPDGYDPNIMAHRAPPPSFNNRPKMDSGQVVLSTEEYKQLLSRIPGAQVPGLMNEEEPINKRAAYNCNGHPMPAETTPPYSAPMSDMSLSRHNSTSSGTEKNHMTHSTVSAIPGNSAQNHFDIASFGMGIVTATGGGDAAEEMYKRMNMFYENCIQSALDSPENQEPKPQEAMIPKEEYMTPTHGFQYQSDPYQVPPAERNINYQLNAAELKALDAVREAFYGMDDPMEQGRQMQSFLKANKTPADIMNIMDVTMRRFVKVAKGVPAFREVSQEGKFSLLKGGMIEMLTVRGVTRYDASTNSFKTPTIKGQNVSVNVDDMFAKLNANAQAQKAKCLEFFGFFDEEIKKNELAVYLVMLAVLFSVRSDPPMNENDVRIVTERHNHFMSLLNRYLESLFGEQARRIFERIPKALGLLNEIARNAGMLFMGTVRSGEAEELPGEFFKIK |
Proteomic databases
Expression
Tissue specificity
Expressed throughout muscles of the pharynx (PubMed:11072073).
Expressed in epidermal seam cells, the vulva, head neurons, mature spermatheca, uterus and intestine (PubMed:10859169, PubMed:23990780).
Expressed in epidermal seam cells, the vulva, head neurons, mature spermatheca, uterus and intestine (PubMed:10859169, PubMed:23990780).
Developmental stage
Widely expressed from embryo through to adult stages; peak expression levels seem to occur during larval stage L2.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, zinc finger, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-15 | Polar residues | ||||
Sequence: MGTNGGVIAEQSMEI | ||||||
Region | 1-109 | Disordered | ||||
Sequence: MGTNGGVIAEQSMEIETNENPDKVEEPVVRRKRVTRRRHRRIHSKNNCLTPPNSDDDPQMSTPDDPVIHSPPSIGAAPGMNGYHGSGVKLEESSGACGSPDDGLLDSSE | ||||||
Compositional bias | 16-31 | Basic and acidic residues | ||||
Sequence: ETNENPDKVEEPVVRR | ||||||
Compositional bias | 46-60 | Polar residues | ||||
Sequence: NNCLTPPNSDDDPQM | ||||||
Zinc finger | 118-138 | NR C4-type | ||||
Sequence: CRVCGDHATGYNFNVITCESC | ||||||
Zinc finger | 154-173 | NR C4-type | ||||
Sequence: CPYSEDCEINSVSRRFCQKC | ||||||
Motif | 191-206 | Nuclear localization signal | ||||
Sequence: EEQLRRRKNSRLNNTG | ||||||
Region | 198-251 | Disordered | ||||
Sequence: KNSRLNNTGTCNKRSQPGNQQSPQGPNQQPHLSPHHPGVAIYPPQPQRPLTINP | ||||||
Compositional bias | 200-228 | Polar residues | ||||
Sequence: SRLNNTGTCNKRSQPGNQQSPQGPNQQPH | ||||||
Region | 266-314 | Disordered | ||||
Sequence: NAMPQLISPPGAQPYPLTSPVGSSASDSPPNRSLTMMHNGEKSPDGYDP | ||||||
Compositional bias | 282-303 | Polar residues | ||||
Sequence: LTSPVGSSASDSPPNRSLTMMH | ||||||
Region | 376-410 | Disordered | ||||
Sequence: GHPMPAETTPPYSAPMSDMSLSRHNSTSSGTEKNH | ||||||
Compositional bias | 388-410 | Polar residues | ||||
Sequence: SAPMSDMSLSRHNSTSSGTEKNH | ||||||
Domain | 516-753 | NR LBD | ||||
Sequence: AELKALDAVREAFYGMDDPMEQGRQMQSFLKANKTPADIMNIMDVTMRRFVKVAKGVPAFREVSQEGKFSLLKGGMIEMLTVRGVTRYDASTNSFKTPTIKGQNVSVNVDDMFAKLNANAQAQKAKCLEFFGFFDEEIKKNELAVYLVMLAVLFSVRSDPPMNENDVRIVTERHNHFMSLLNRYLESLFGEQARRIFERIPKALGLLNEIARNAGMLFMGTVRSGEAEELPGEFFKIK |
Sequence similarities
Belongs to the nuclear hormone receptor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing & Alternative initiation.
G5EFF5-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- SynonymsA1
- Length753
- Mass (Da)84,199
- Last updated2011-12-14 v1
- ChecksumBD166E3A0ED95D08
G5EFF5-2
- Nameb
- SynonymsA2
- NoteProduced by alternative initiation at Met-60 of isoform a.
- Differences from canonical
- 1-59: Missing
G5EFF5-3
- Namec
- SynonymsB
- NoteProduced by alternative initiation at Met-487 of isoform a.
- Differences from canonical
- 1-486: Missing
G5EFF5-4
- Named
- NoteProduced by alternative splicing.
- Differences from canonical
- 1-57: MGTNGGVIAEQSMEIETNENPDKVEEPVVRRKRVTRRRHRRIHSKNNCLTPPNSDDD → MADNLLSSQNYINWTMLNKFYGK
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A6V7QZA2 | A0A6V7QZA2_CAEEL | daf-12 | 678 | ||
A0A6V7QYS9 | A0A6V7QYS9_CAEEL | daf-12 | 737 | ||
A0A6V7QZ48 | A0A6V7QZ48_CAEEL | daf-12 | 703 |
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-15 | Polar residues | ||||
Sequence: MGTNGGVIAEQSMEI | ||||||
Alternative sequence | VSP_057860 | 1-57 | in isoform d | |||
Sequence: MGTNGGVIAEQSMEIETNENPDKVEEPVVRRKRVTRRRHRRIHSKNNCLTPPNSDDD → MADNLLSSQNYINWTMLNKFYGK | ||||||
Alternative sequence | VSP_057859 | 1-59 | in isoform b | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_057858 | 1-486 | in isoform c | |||
Sequence: Missing | ||||||
Compositional bias | 16-31 | Basic and acidic residues | ||||
Sequence: ETNENPDKVEEPVVRR | ||||||
Compositional bias | 46-60 | Polar residues | ||||
Sequence: NNCLTPPNSDDDPQM | ||||||
Compositional bias | 200-228 | Polar residues | ||||
Sequence: SRLNNTGTCNKRSQPGNQQSPQGPNQQPH | ||||||
Compositional bias | 282-303 | Polar residues | ||||
Sequence: LTSPVGSSASDSPPNRSLTMMH | ||||||
Compositional bias | 388-410 | Polar residues | ||||
Sequence: SAPMSDMSLSRHNSTSSGTEKNH |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF136238 EMBL· GenBank· DDBJ | AAD34462.1 EMBL· GenBank· DDBJ | mRNA | ||
AF136239 EMBL· GenBank· DDBJ | AAD34463.1 EMBL· GenBank· DDBJ | mRNA | ||
AF136240 EMBL· GenBank· DDBJ | AAD34464.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284606 EMBL· GenBank· DDBJ | CAC42283.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284606 EMBL· GenBank· DDBJ | CAC42284.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284606 EMBL· GenBank· DDBJ | CAC42285.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284606 EMBL· GenBank· DDBJ | CAJ43436.1 EMBL· GenBank· DDBJ | Genomic DNA |