G5EEG7 · SMU1_CAEEL
- ProteinSmu-1 suppressor of mec-8 and unc-52 protein
- Genesmu-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids510 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in pre-mRNA splicing as a component of the spliceosome (By similarity).
Selectively regulates alternative splicing of unc-52 exon 17 (PubMed:11438655, PubMed:15254247).
Thus, smu-1 mutants selectively suppress the effects of unc-52 nonsense mutations in exon 17 by promoting the accumulation of unc-52 isoforms that lack exon 17 and enhance the effects of unc-52 mutations that affect the exon 16 splice donor site (PubMed:11438655, PubMed:15254247).
In contrast, smu-1 mutants do not suppress unc-52 nonsense mutations in exon 18 (PubMed:11438655).
Selectively regulates alternative splicing of unc-52 exon 17 (PubMed:11438655, PubMed:15254247).
Thus, smu-1 mutants selectively suppress the effects of unc-52 nonsense mutations in exon 17 by promoting the accumulation of unc-52 isoforms that lack exon 17 and enhance the effects of unc-52 mutations that affect the exon 16 splice donor site (PubMed:11438655, PubMed:15254247).
In contrast, smu-1 mutants do not suppress unc-52 nonsense mutations in exon 18 (PubMed:11438655).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | precatalytic spliceosome | |
Cellular Component | U2-type precatalytic spliceosome | |
Molecular Function | identical protein binding | |
Molecular Function | protein homodimerization activity | |
Biological Process | embryo development ending in birth or egg hatching | |
Biological Process | locomotion | |
Biological Process | mechanosensory behavior | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | muscle organ morphogenesis | |
Biological Process | nematode larval development | |
Biological Process | neuron development | |
Biological Process | regulation of alternative mRNA splicing, via spliceosome | |
Biological Process | RNA splicing |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSmu-1 suppressor of mec-8 and unc-52 protein
- Short namesSmu1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5EEG7
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 15 | Mildly reduces homodimerization. | ||||
Sequence: I → A | ||||||
Mutagenesis | 15 | Disrupts homodimerization. | ||||
Sequence: I → R | ||||||
Mutagenesis | 18 | Disrupts homodimerization. | ||||
Sequence: F → S or R | ||||||
Mutagenesis | 96 | Disrupts interaction with smu-2. | ||||
Sequence: L → R | ||||||
Mutagenesis | 255-510 | In mn415; enhances accumulation of an alternatively spliced isoform of unc-52 that skips exon 17. Selective suppressor of unc-52 missense mutations in exon 17. | ||||
Sequence: Missing |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000441748 | 1-510 | Smu-1 suppressor of mec-8 and unc-52 protein | |||
Sequence: MSSIEIESSDVIRLIEQFLKESNLHRTLAILQEETNVSLNTVDSIDGFCNEITSGNWDNVLKTVQSLKLPAKKLIDLYEHVIIELVELRELATARLVARQTDPMILLKQIDPDRFARLESLINRPYFDGQEVYGDVSKEKRRSVIAQTLSSEVHVVAPSRLLSLLGQSLKWQLHQGLLPPGTAIDLFRGKAAQKEQIEERYPTMMARSIKFSTKSYPESAVFSPDANYLVSGSKDGFIEVWNYMNGKLRKDLKYQAQDNLMMMDAAVRCISFSRDSEMLATGSIDGKIKVWKVETGDCLRRFDRAHTKGVCAVRFSKDNSHILSGGNDHVVRVHGMKSGKCLKEMRGHSSYITDVRYSDEGNHIISCSTDGSIRVWHGKSGECLSTFRVGSEDYPILNVIPIPKSDPPQMIVCNRSNTLYVVNISGQVVRTMTSGKREKGDFINCILSPKGEWAYAIAEDGVMYCFMVLSGTLETTLPVTERLPIGLAHHPHQNLIASYAEDGLLKLWTD |
Proteomic databases
Expression
Tissue specificity
Ubiquitous. Detected in the intestine and germline in adult hermaphrodites.
Developmental stage
Ubiquitous. Detected throughout embryonic and larval development and in adult hermaphrodites.
Gene expression databases
Interaction
Subunit
Component of the spliceosome B complex (By similarity).
Homodimer (via LisH domain) (PubMed:27150041).
The homodimer interacts (via the N-terminal region including the LisH and CTLH domains) with smu-2, giving rise to a heterotetramer (PubMed:15254247, PubMed:27150041).
Homodimer (via LisH domain) (PubMed:27150041).
The homodimer interacts (via the N-terminal region including the LisH and CTLH domains) with smu-2, giving rise to a heterotetramer (PubMed:15254247, PubMed:27150041).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | G5EEG7 | smu-1 G5EEG7 | 3 | EBI-2411547, EBI-2411547 | |
BINARY | G5EEG7 | smu-2 Q9N4U5 | 6 | EBI-2411547, EBI-2415311 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-181 | Required and sufficient for interaction with smu-2 | ||||
Sequence: MSSIEIESSDVIRLIEQFLKESNLHRTLAILQEETNVSLNTVDSIDGFCNEITSGNWDNVLKTVQSLKLPAKKLIDLYEHVIIELVELRELATARLVARQTDPMILLKQIDPDRFARLESLINRPYFDGQEVYGDVSKEKRRSVIAQTLSSEVHVVAPSRLLSLLGQSLKWQLHQGLLPPG | ||||||
Domain | 7-39 | LisH | ||||
Sequence: ESSDVIRLIEQFLKESNLHRTLAILQEETNVSL | ||||||
Domain | 41-93 | CTLH | ||||
Sequence: TVDSIDGFCNEITSGNWDNVLKTVQSLKLPAKKLIDLYEHVIIELVELRELAT | ||||||
Repeat | 212-251 | WD 1 | ||||
Sequence: STKSYPESAVFSPDANYLVSGSKDGFIEVWNYMNGKLRKD | ||||||
Repeat | 260-301 | WD 2 | ||||
Sequence: LMMMDAAVRCISFSRDSEMLATGSIDGKIKVWKVETGDCLRR | ||||||
Repeat | 303-344 | WD 3 | ||||
Sequence: DRAHTKGVCAVRFSKDNSHILSGGNDHVVRVHGMKSGKCLKE | ||||||
Repeat | 345-379 | WD 4 | ||||
Sequence: MRGHSSYITDVRYSDEGNHIISCSTDGSIRVWHGK | ||||||
Repeat | 380-423 | WD 5 | ||||
Sequence: SGECLSTFRVGSEDYPILNVIPIPKSDPPQMIVCNRSNTLYVVN | ||||||
Repeat | 425-467 | WD 6 | ||||
Sequence: SGQVVRTMTSGKREKGDFINCILSPKGEWAYAIAEDGVMYCFM | ||||||
Repeat | 470-509 | WD 7 | ||||
Sequence: SGTLETTLPVTERLPIGLAHHPHQNLIASYAEDGLLKLWT |
Domain
The WD repeats assemble into a seven-bladed WD propeller.
Sequence similarities
Belongs to the WD repeat SMU1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length510
- Mass (Da)57,251
- Last updated2011-12-14 v1
- Checksum8D8CBAEF0FE9E2B6
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF330595 EMBL· GenBank· DDBJ | AAK00353.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284601 EMBL· GenBank· DDBJ | CAB04014.1 EMBL· GenBank· DDBJ | Genomic DNA |