G5ED36 · G5ED36_CAEEL
- ProteinEndocytosis protein RME-8
- Generme-8
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids2279 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | early endosome | |
Cellular Component | endosome membrane | |
Cellular Component | late endosome | |
Cellular Component | recycling endosome | |
Molecular Function | identical protein binding | |
Molecular Function | protein-folding chaperone binding | |
Biological Process | embryo development ending in birth or egg hatching | |
Biological Process | endosome organization | |
Biological Process | mechanosensory behavior | |
Biological Process | nematode larval development | |
Biological Process | positive regulation of nematode male tail tip morphogenesis | |
Biological Process | protein localization to postsynaptic membrane | |
Biological Process | receptor-mediated endocytosis | |
Biological Process | regulation of early endosome to late endosome transport | |
Biological Process | retrograde transport, endosome to Golgi |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5ED36
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | G5ED36 | rme-8 G5ED36 | 2 | EBI-7243855, EBI-7243855 | |
BINARY | G5ED36 | snx-1 Q9GYJ9 | 3 | EBI-7243855, EBI-314346 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1321-1405 | J | ||||
Sequence: LAREILSVDLTNEEHRKPAFIRRQYYKLAAKYHPDKNPEGREMFERINAAYELLSSETANNSGMPDSHRIVLCLQAQSIIYSRYS | ||||||
Region | 2258-2279 | Disordered | ||||
Sequence: PPPMSNQPPPMHQTSGDFQPPL | ||||||
Compositional bias | 2259-2279 | Pro residues | ||||
Sequence: PPMSNQPPPMHQTSGDFQPPL |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,279
- Mass (Da)259,168
- Last updated2011-12-14 v1
- Checksum4C9830523CB640B6
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O62178 | O62178_CAEEL | rme-8 | 2271 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 2259-2279 | Pro residues | ||||
Sequence: PPMSNQPPPMHQTSGDFQPPL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF372457 EMBL· GenBank· DDBJ | AAK54248.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284601 EMBL· GenBank· DDBJ | CAA99831.3 EMBL· GenBank· DDBJ | Genomic DNA |