G5ECZ4 · DYF2_CAEEL
- ProteinWD repeat-containing protein dyf-2
- Genedyf-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1383 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport (PubMed:28479320).
Moves along the ciliary axoneme and is involved in the assembly, localization and the movement of other intraflagellar transport (IFT) proteins along the cilia axoneme (PubMed:16957054, PubMed:22922713).
May also associate with the BBSome complex in order to mediate ciliary transport (PubMed:22922713).
Regulates cilia biogenesis, morphology and sensitivity to environmental cues (PubMed:16957054, PubMed:22922713).
Moves along the ciliary axoneme and is involved in the assembly, localization and the movement of other intraflagellar transport (IFT) proteins along the cilia axoneme (PubMed:16957054, PubMed:22922713).
May also associate with the BBSome complex in order to mediate ciliary transport (PubMed:22922713).
Regulates cilia biogenesis, morphology and sensitivity to environmental cues (PubMed:16957054, PubMed:22922713).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cilium | |
Cellular Component | intraciliary transport particle A | |
Cellular Component | intraciliary transport particle B | |
Cellular Component | non-motile cilium | |
Biological Process | chemosensory behavior | |
Biological Process | chemotaxis | |
Biological Process | cilium assembly | |
Biological Process | intraciliary retrograde transport | |
Biological Process | intraciliary transport | |
Biological Process | non-motile cilium assembly | |
Biological Process | olfactory behavior | |
Biological Process | protein localization | |
Biological Process | protein transport |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameWD repeat-containing protein dyf-2
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5ECZ4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Defects in cilium morphology and mislocalization of intraflagellar transport proteins. Specifically, phasmid cilia are shorter compared to wild-type, ciliary IFT A complex proteins such as che-11, osm-5 are mislocalized, and the transport and accumulation of the ciliary IFT B complex protein che-13 is impaired. Mutants also display a strong osmosensory (osm) phenotype with an aversion to high osmolarity, and they exhibit impaired chemotaxis in response to volatile odorants such as pyrazine and iso-amyl alcohol.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 361 | In jhu616; the mutated protein displays abnormal accumulation within the cilia. There is also impaired retrograde transport of IFT complex B proteins such as osm-6 along the ciliary axoneme. | ||||
Sequence: G → R |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000437075 | 1-1383 | WD repeat-containing protein dyf-2 | |||
Sequence: MSLKVIPCTLTKNQEVFKCVSAQLQYRRGEEEHGSGPIIHRWRPNGHTVAVACANNTVIYYDKKGNVIDALNPTGKLIDIAWDKEGDVLAIAVANTGTIYLWDVNSRNTDTVESGATSSKELPTCLAWSPSTPTLVIGNNAGNIVVYNHRTSRRIAVMGKHQRSVTQITVTPEDYVISCSDDNTLSVTTLEGTTVSTTTTNGEPTNMDYGSVNGKGGSGVTMVSVVIGKKILMLAHYNALDEPVNLQFQEKYGNIHSYRWFNDGYILIGFDRGYIISISAHNNEIGSELVSFLEYRGYLASIAVSTSFNKLLTIGDNMVKVRDLDELTTVTMLTEIETEKNLSEIEVTEDGQLVAVSSQSGVLSIFVTKMPTLAASYNNSICYLTNLTQVTVVAEVEKKGSSTLELNIEPTVMGLGPLNLAVANNNTVFFYDYHTPAQMQAAQQLQSTQSAAEKPTIVAAEPINRVEYLSTVTNIQLNYMYAAVNFGSRLRLHRIRNSEDNVSIEFPEANRNATLYSYALTENFLIFTTSNNYIVYFSLSEWAIVSEYRHVVPVRSIFPHPTNVVCCCFDDRLEAMIYSAVDDEVFRLPSVGSSAHYKGAIWETFTIDKNTFAVFDSQNIYVFLLSKQHIQGESVIYVSATRLPHAYVPLSLNKGIVTCLMSNGKLSSVLLDSHKTESVISDKSETVIDDILTRSLLMHRWSTAWKICIHSNDGSHWNQFAMAALLDSDVGMAIKIFREIGDAAMVTALELIETIEEKNLLHAQIYTILSRYDDAEQLYLESSRPMEALNMRRDLLEWPKALVLAETMNPKEIPYLSKEYAQELELTGDHANSLANYEKGVMENPQNLPELQEHNEICQSGIARMAIKTGDLRRGVQLAKQLEGRVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAAAVCLKANAWAKVGELLDHVKSPKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQVRLLLDPLNDPDEAVRVVRESRSIEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAFELAEKNNAVREYAKAIEQHGNISQALELAEYYNRVNDMFMAAKFYTQAGQYNNAINLLFKNGDDENCVALAVDCGIKSKDKTLNNKLVKFLLGEDGNVKDPAQLFRLYVGLGRTKDAAQTAVVVAQIHQAKGNYRIARDLLFQMHQQLREKMMRIPLDMNKSLMAIHSYIIVKALINRKETLLAARLLIRTCGEIQRFPTHVVPILTSSVVICTQANLKKSAHKFAAQLMTPEYRPKIHEKYKKKIEDIVRKGGNQKDLVEENTPCPICDDLMPAYAMSCDNCKSLVPYCILTGRHIVASDFSRCPHCEMPGFYSEFRKLSILNENCYMCGGDLKGAIPEDAKAYLEKMEQDYK |
Proteomic databases
Expression
Interaction
Subunit
Component of the IFT complex A (IFT-A) composed of at least che-11, daf-10, dyf-2, ift-139, ift-43 and ifta-1.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 32-71 | WD 1 | ||||
Sequence: EHGSGPIIHRWRPNGHTVAVACANNTVIYYDKKGNVIDAL | ||||||
Repeat | 72-112 | WD 2 | ||||
Sequence: NPTGKLIDIAWDKEGDVLAIAVANTGTIYLWDVNSRNTDTV | ||||||
Repeat | 118-157 | WD 3 | ||||
Sequence: SSKELPTCLAWSPSTPTLVIGNNAGNIVVYNHRTSRRIAV | ||||||
Repeat | 160-198 | WD 4 | ||||
Sequence: KHQRSVTQITVTPEDYVISCSDDNTLSVTTLEGTTVSTT | ||||||
Repeat | 337-376 | WD 5 | ||||
Sequence: ETEKNLSEIEVTEDGQLVAVSSQSGVLSIFVTKMPTLAAS | ||||||
Repeat | 756-789 | TPR 1 | ||||
Sequence: EEKNLLHAQIYTILSRYDDAEQLYLESSRPMEAL | ||||||
Repeat | 810-847 | TPR 2 | ||||
Sequence: PKEIPYLSKEYAQELELTGDHANSLANYEKGVMENPQN | ||||||
Repeat | 885-918 | TPR 3 | ||||
Sequence: RVVKRDCAIILEQMKQYTEAAQLYEVGLFYDRAA | ||||||
Repeat | 940-973 | TPR 4 | ||||
Sequence: PKIHIQYGKIMEKEKKYKVAVKCYETGRDYDNQV | ||||||
Repeat | 996-1029 | TPR 5 | ||||
Sequence: IEGAKLVAKFFVKLGDYNSAIQFLVMSQCVQEAF | ||||||
Repeat | 1031-1053 | TPR 6 | ||||
Sequence: LAEKNNAVREYAKAIEQHGNISQ | ||||||
Repeat | 1064-1097 | TPR 7 | ||||
Sequence: VNDMFMAAKFYTQAGQYNNAINLLFKNGDDENCV |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
G5ECZ4-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length1,383
- Mass (Da)155,025
- Last updated2011-12-14 v1
- Checksum46B0CBD50F278CCE
G5ECZ4-2
- Nameb
- Differences from canonical
- 1-807: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_058484 | 1-807 | in isoform b | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DQ314286 EMBL· GenBank· DDBJ | ABC42046.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284603 EMBL· GenBank· DDBJ | CAL49447.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284603 EMBL· GenBank· DDBJ | CAL49448.1 EMBL· GenBank· DDBJ | Genomic DNA |