G5ECT0 · PBO5_CAEEL
- ProteinProton-gated ion channel subunit pbo-5
- Genepbo-5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids509 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Forms a proton-gated ion channel with pbo-6 that is activated by acidification of the posterior coelomic space, leading to posterior body wall muscle contraction (pBoc) during the defecation cycle (PubMed:18191228).
Probably by regulating the defecation motor program, required for fatty acid uptake by intestinal cells (PubMed:25849533).
Does not bind neurotransmitters such as acetylcholine, gamma-aminobutyric acid, glycine, serotonin, glutamate or choline (PubMed:18191228).
Probably by regulating the defecation motor program, required for fatty acid uptake by intestinal cells (PubMed:25849533).
Does not bind neurotransmitters such as acetylcholine, gamma-aminobutyric acid, glycine, serotonin, glutamate or choline (PubMed:18191228).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | synapse | |
Cellular Component | transmembrane transporter complex | |
Molecular Function | extracellular ligand-gated monoatomic ion channel activity | |
Molecular Function | neurotransmitter receptor activity | |
Molecular Function | transmembrane signaling receptor activity | |
Biological Process | defecation | |
Biological Process | lipid transport involved in lipid storage | |
Biological Process | positive regulation of intestinal lipid absorption | |
Biological Process | positive regulation of striated muscle contraction |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProton-gated ion channel subunit pbo-5
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5ECT0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 22-275 | Extracellular | ||||
Sequence: TSTTESYFDSSEEAPNVLLNHLNNESEGEELTQINDTQPAFVPGSSKRLTEYLLSRHNLNAPPDGLLYVEYELELVHILGIDELKQTMTVLIYVDEHWVDPSLTWDPALFGGITKTWIPLDKIWVPDIIVFNMVKSNRLAHEDLLSAVRAPARIHYNGTIVASHPAVHTVSCEINIRHFPLDDQRCAIEIASWAYGQEKIRLHAHTDHSLEHYKRNEEWHLLNLNVSEEKYEHEGVEVSEVKFEISLKRRPLFY | ||||||
Transmembrane | 276-296 | Helical | ||||
Sequence: MVTLTFPSYIMCAISVVGLFA | ||||||
Transmembrane | 310-330 | Helical | ||||
Sequence: LGVTAILTMAVLSLVVSEKVP | ||||||
Transmembrane | 336-356 | Helical | ||||
Sequence: VPLLVAYFLFNMVIVSIAAMT | ||||||
Topological domain | 357-487 | Cytoplasmic | ||||
Sequence: TGIVMKVHRLGRYGDEPSDFWMRCFLLKPVFRTSNRRKYRMNPEEPTQVILVSEAKNGEVLTKKSTELNGTVVKEIMLSSRLEALEEYIRKMVNRCETIKWELDEIDAAENIELVRRRSTNGYVRISERLD | ||||||
Transmembrane | 488-508 | Helical | ||||
Sequence: ILFMFLFLSTVTIPVAVLFYL |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Loss of posterior body wall muscle contractions (pBoc).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 186 | In sa242; defective in posterior body wall contraction (pBoc). | ||||
Sequence: P → L | ||||||
Mutagenesis | 189 | In ox9; defective in posterior body wall contraction (pBoc). | ||||
Sequence: H → Q | ||||||
Mutagenesis | 309 | In ox38; defective in posterior body wall contraction (pBoc). | ||||
Sequence: T → I | ||||||
Mutagenesis | 321 | In ox7dm; defective in posterior body wall contraction (pBoc). | ||||
Sequence: L → F | ||||||
Mutagenesis | 330 | In ox34; defective in posterior body wall contraction (pBoc). | ||||
Sequence: P → L | ||||||
Mutagenesis | 347 | In sa297; defective in posterior body wall contraction (pBoc). | ||||
Sequence: M → T |
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MTRLSILQHLLTFLILSKINA | ||||||
Chain | PRO_0000424148 | 22-509 | Proton-gated ion channel subunit pbo-5 | |||
Sequence: TSTTESYFDSSEEAPNVLLNHLNNESEGEELTQINDTQPAFVPGSSKRLTEYLLSRHNLNAPPDGLLYVEYELELVHILGIDELKQTMTVLIYVDEHWVDPSLTWDPALFGGITKTWIPLDKIWVPDIIVFNMVKSNRLAHEDLLSAVRAPARIHYNGTIVASHPAVHTVSCEINIRHFPLDDQRCAIEIASWAYGQEKIRLHAHTDHSLEHYKRNEEWHLLNLNVSEEKYEHEGVEVSEVKFEISLKRRPLFYMVTLTFPSYIMCAISVVGLFARFSTTGEREERFTLGVTAILTMAVLSLVVSEKVPHSSTHVPLLVAYFLFNMVIVSIAAMTTGIVMKVHRLGRYGDEPSDFWMRCFLLKPVFRTSNRRKYRMNPEEPTQVILVSEAKNGEVLTKKSTELNGTVVKEIMLSSRLEALEEYIRKMVNRCETIKWELDEIDAAENIELVRRRSTNGYVRISERLDILFMFLFLSTVTIPVAVLFYLT | ||||||
Disulfide bond | 193↔207 | |||||
Sequence: CEINIRHFPLDDQRC |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Expressed in the posterior body muscles. Also detected in the RIFL, RIFR and RIS head neurons.
Gene expression databases
Interaction
Subunit
The functional channel is a heterooligomer of pbo-5 and pbo-6. May self-associate to form homooligomers with negligible ion channel activity.
Protein-protein interaction databases
Structure
Family & Domains
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
G5ECT0-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Nameb
- Length509
- Mass (Da)58,441
- Last updated2011-12-14 v1
- Checksum3D7A3C3960B96D10
G5ECT0-2
- Namea
- Differences from canonical
- 155-159: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_053336 | 155-159 | in isoform a | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL033511 EMBL· GenBank· DDBJ | CAH19091.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL033515 EMBL· GenBank· DDBJ | CAH19091.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81512 EMBL· GenBank· DDBJ | CAH19091.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL033511 EMBL· GenBank· DDBJ | CAA22072.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL033515 EMBL· GenBank· DDBJ | CAA22072.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z81512 EMBL· GenBank· DDBJ | CAA22072.2 EMBL· GenBank· DDBJ | Genomic DNA |