G5ECR9 · UNC55_CAEEL
- ProteinNuclear hormone receptor unc-55
- Geneunc-55
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids370 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor (PubMed:28056346, PubMed:29033363).
Involved in motor neuron fate determination and maintenance, acting as a transcriptional repressor to counteract gene activation by transcription factors unc-3 or irx-1 in subsets of motor neurons (PubMed:22031882, PubMed:28056346).
Probably acts by binding to specific promoter elements (PubMed:28056346).
Required for ventral D (VD) motor neurons to adopt their normal synaptic pattern (PubMed:22031882, PubMed:7869081).
Suppresses expression of flp-13 in VD motor neurons to ensure formation of the correct synaptic pattern (PubMed:15882588).
Maintains low cAMP levels in VD motor neurons by enhancing expression of pde-4 which hydrolyzes cAMP and repressing expression of acy-1 which catalyzes cAMP formation (PubMed:29033363).
This prevents respecification of synapses by VD neurons (PubMed:29033363).
During copulation, required in males for correct movement of the spicules, a pair of prong-like structures which are inserted into the vulva of the hermaphrodite and anchor the male to the hermaphrodite (PubMed:18652814).
Required for spicule prodding which allows detection of the vulva location and for spicule insertion into the vulva (PubMed:18652814).
Involved in motor neuron fate determination and maintenance, acting as a transcriptional repressor to counteract gene activation by transcription factors unc-3 or irx-1 in subsets of motor neurons (PubMed:22031882, PubMed:28056346).
Probably acts by binding to specific promoter elements (PubMed:28056346).
Required for ventral D (VD) motor neurons to adopt their normal synaptic pattern (PubMed:22031882, PubMed:7869081).
Suppresses expression of flp-13 in VD motor neurons to ensure formation of the correct synaptic pattern (PubMed:15882588).
Maintains low cAMP levels in VD motor neurons by enhancing expression of pde-4 which hydrolyzes cAMP and repressing expression of acy-1 which catalyzes cAMP formation (PubMed:29033363).
This prevents respecification of synapses by VD neurons (PubMed:29033363).
During copulation, required in males for correct movement of the spicules, a pair of prong-like structures which are inserted into the vulva of the hermaphrodite and anchor the male to the hermaphrodite (PubMed:18652814).
Required for spicule prodding which allows detection of the vulva location and for spicule insertion into the vulva (PubMed:18652814).
Isoform a
Required for normal locomotion.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 18-93 | Nuclear receptor | ||||
Sequence: ATDCVVCGDKSSGKHYGQFSCEGCKSFFKRSIRRSLSYTCRATKNCAIDVQHRNQCQYCRLTKCIRMGMRKEGRRS |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | nuclear receptor activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | cell differentiation | |
Biological Process | cell fate specification | |
Biological Process | hormone-mediated signaling pathway | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | neuron remodeling | |
Biological Process | positive regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNuclear hormone receptor unc-55
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5ECR9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 195-370 | In ot718; uncoordinated locomotory phenotype. Induces ectopic expression of TGF-b family members unc-129 and dbl-1, and of potassium channel slo-2, in AS motor neurons. Ectopic expression is repressed in an unc-3 mutant background. | ||||
Sequence: Missing |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000446101 | 1-370 | Nuclear hormone receptor unc-55 | |||
Sequence: MQDGSSGAASLGNSSPDATDCVVCGDKSSGKHYGQFSCEGCKSFFKRSIRRSLSYTCRATKNCAIDVQHRNQCQYCRLTKCIRMGMRKEGRRSNETQTAVSAVQRGRLPVTMPSLFPPNMFLRSPFPFMSVPFNPLMTAQFTKPSIKESIFEFAAQTIFATVNWARTSMSNLVKGDQLILLRHSWTPIFIFALAQSNFALNLSTHLTAVTATAASTENGSSSLGSKSEDEEKSEEKPERVFDEPQFQGFQAKIDKIRDFHLDVVESSSLRAVLLFSCDEEALEEKGKIEEIVEKLKSAVDEYCKMNKRSERYHQICECLQLLKSTRNLPISRLFFSRLLGTTPLETILSDLLITPPPPTLPFFPQLPSRN |
Proteomic databases
Expression
Tissue specificity
Expressed in spicule protractor and retractor muscles, and the male-specific neuron CP9 (PubMed:18652814).
Expressed in the nerve ring, and preanal ganglion (PubMed:9852581).
Expressed in asymmetric motor neurons (PubMed:29033363, PubMed:9852581).
Expressed in ventral D motor neurons (PubMed:15882588, PubMed:29033363, PubMed:7869081, PubMed:9852581).
Isoform a: Expressed in males and hermaphrodites (PubMed:18652814).
Isoform b: Only expressed in males (PubMed:18652814).
Expressed in the nerve ring, and preanal ganglion (PubMed:9852581).
Expressed in asymmetric motor neurons (PubMed:29033363, PubMed:9852581).
Expressed in ventral D motor neurons (PubMed:15882588, PubMed:29033363, PubMed:7869081, PubMed:9852581).
Isoform a: Expressed in males and hermaphrodites (PubMed:18652814).
Isoform b: Only expressed in males (PubMed:18652814).
Developmental stage
Expression in the asymmetric and ventral D motor neurons in the ventral nerve cord is restricted to the postembryonic stages L2 and L3.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for zinc finger, domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 21-41 | NR C4-type | ||||
Sequence: CVVCGDKSSGKHYGQFSCEGC | ||||||
Zinc finger | 57-76 | NR C4-type | ||||
Sequence: CRATKNCAIDVQHRNQCQYC | ||||||
Domain | 95-355 | NR LBD | ||||
Sequence: ETQTAVSAVQRGRLPVTMPSLFPPNMFLRSPFPFMSVPFNPLMTAQFTKPSIKESIFEFAAQTIFATVNWARTSMSNLVKGDQLILLRHSWTPIFIFALAQSNFALNLSTHLTAVTATAASTENGSSSLGSKSEDEEKSEEKPERVFDEPQFQGFQAKIDKIRDFHLDVVESSSLRAVLLFSCDEEALEEKGKIEEIVEKLKSAVDEYCKMNKRSERYHQICECLQLLKSTRNLPISRLFFSRLLGTTPLETILSDLLITP | ||||||
Region | 216-240 | Disordered | ||||
Sequence: TENGSSSLGSKSEDEEKSEEKPERV | ||||||
Compositional bias | 224-240 | Basic and acidic residues | ||||
Sequence: GSKSEDEEKSEEKPERV | ||||||
Region | 344-355 | AF-2 | ||||
Sequence: LETILSDLLITP |
Sequence similarities
Belongs to the nuclear hormone receptor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
G5ECR9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length370
- Mass (Da)41,505
- Last updated2011-12-14 v1
- Checksum3CACA8E42B8D3D3B
G5ECR9-2
- Nameb
- Differences from canonical
- 90-102: Missing
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_060026 | 90-102 | in isoform b | |||
Sequence: Missing | ||||||
Compositional bias | 224-240 | Basic and acidic residues | ||||
Sequence: GSKSEDEEKSEEKPERV |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EF601082 EMBL· GenBank· DDBJ | ABQ96204.1 EMBL· GenBank· DDBJ | mRNA | ||
EF601077 EMBL· GenBank· DDBJ | ABQ96199.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284601 EMBL· GenBank· DDBJ | CAP16277.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284601 EMBL· GenBank· DDBJ | CAP16278.2 EMBL· GenBank· DDBJ | Genomic DNA |