G5EC26 · G5EC26_CAEEL
- ProteinCalcium-transporting ATPase
- Genepmr-1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids705 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Catalyzes the hydrolysis of ATP coupled with the transport of calcium.
Catalytic activity
- ATP + Ca2+(in) + H2O = ADP + Ca2+(out) + H+ + phosphate
CHEBI:30616 + Ca2+ (in)CHEBI:29108+ CHEBI:15377 = CHEBI:456216 + Ca2+ (out)CHEBI:29108+ CHEBI:15378 + CHEBI:43474 - ATP + H2O + Mn2+(in) = ADP + H+ + Mn2+(out) + phosphateThis reaction proceeds in the forward direction.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi membrane | |
Cellular Component | membrane | |
Cellular Component | plasma membrane | |
Cellular Component | sarcoplasmic reticulum | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | P-type calcium transporter activity | |
Molecular Function | P-type manganese transporter activity | |
Biological Process | calcium ion transmembrane transport | |
Biological Process | calcium ion transport | |
Biological Process | intracellular calcium ion homeostasis | |
Biological Process | manganese ion transport | |
Biological Process | regulation of cell migration | |
Biological Process | response to calcium ion | |
Biological Process | response to manganese ion | |
Biological Process | response to oxidative stress |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCalcium-transporting ATPase
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5EC26
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 63-81 | Helical | ||||
Sequence: FQNPLILLLLASAFVSIVM | ||||||
Transmembrane | 87-103 | Helical | ||||
Sequence: AISITVAVVIVVTVGFV | ||||||
Transmembrane | 255-274 | Helical | ||||
Sequence: LSIYSFGVIAVIFLIGMFQG | ||||||
Transmembrane | 280-306 | Helical | ||||
Sequence: MFTIGVSLAVAAIPEGLPIVVAVTLAI |
Keywords
- Cellular component
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 9-83 | Cation-transporting P-type ATPase N-terminal | ||||
Sequence: QAASHEVVPCTHQLRTNLEEGLTTAEATRRRQYHGYNEFDVGEEEPIYKKYLEQFQNPLILLLLASAFVSIVMKQ | ||||||
Region | 170-189 | Disordered | ||||
Sequence: SSLTGETEPKHKETRSVPAA |
Sequence similarities
Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length705
- Mass (Da)76,541
- Last updated2011-12-14 v1
- Checksum1E4248FCE9E9FEC7
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284601 EMBL· GenBank· DDBJ | CAB05001.1 EMBL· GenBank· DDBJ | Genomic DNA |