G5EBM1 · CSP1_CAEEL
- ProteinCaspase A
- Genecsp-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids536 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cysteine protease which, in vitro, cleaves itself and caspase ced-3 into their mature active forms (PubMed:9857046).
Also cleaves, in vitro, inactive caspase csp-2 isoform b (PubMed:9857046).
Required maternally to induce apoptosis in a subset of cells fated to die during embryogenesis, mostly independently of the ced-9, ced-4 and ced-3 canonical apoptosis pathway (PubMed:23505386).
Involved in the degeneration of dopaminergic CEP neurons in response to high Mn2+ levels (PubMed:23721876).
Also cleaves, in vitro, inactive caspase csp-2 isoform b (PubMed:9857046).
Required maternally to induce apoptosis in a subset of cells fated to die during embryogenesis, mostly independently of the ced-9, ced-4 and ced-3 canonical apoptosis pathway (PubMed:23505386).
Involved in the degeneration of dopaminergic CEP neurons in response to high Mn2+ levels (PubMed:23721876).
Isoform a
Dispensable for regulating apoptosis during embryogenesis.
Catalytic activity
Activity regulation
Inhibited by cysteine protease inhibitor iodoacetic acid (CH3COOI) but not by N-[N-(L-3-transcarboxirane-2-carbonyl)-leucyl]-agmatine (E-64) or benzyloxycarbonyl-DEVD-fluoro-methyl ketone (Z-DEVD-FMK).
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 364 | |||||
Sequence: H | ||||||
Active site | 406 | |||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | germ cell nucleus | |
Molecular Function | cysteine-type endopeptidase activity | |
Biological Process | activation of cysteine-type endopeptidase activity | |
Biological Process | apoptotic process | |
Biological Process | negative regulation of cellular response to manganese ion | |
Biological Process | positive regulation of apoptotic process involved in development | |
Biological Process | positive regulation of cellular response to gamma radiation | |
Biological Process | positive regulation of neuron apoptotic process | |
Biological Process | protein autoprocessing | |
Biological Process | protein processing | |
Biological Process | proteolysis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCaspase A
- EC number
- Cleaved into 2 chains
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionG5EBM1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Disruption phenotype
Survival of touch neurons and several pharyngeal cells is not affected during development and no extra pharyngeal cells caused by impaired apoptosis are produced (PubMed:23505386).
Basal and ionizing radiation-induced germline apoptosis are normal (PubMed:23505386).
In a ced-3 n2427 mutant background, more animals have the M4 sister cell that survives (PubMed:23505386).
In a csp-3 n4872, csp-2 n4871 and ced-3 n3692 mutant background where the canonical apoptotic pathway is impaired, 16 percent of animals have still 1 or more cell corpses that are morphologically apoptotic and are internalized by engulfing cells (PubMed:23505386).
In addition, apoptosis of the male linker cell occurs normally (PubMed:23505386).
RNAi-mediated knockdown causes a 50 percent inhibition of Mn2+-induced dopaminergic CEP neuron degeneration (PubMed:23721876).
Basal and ionizing radiation-induced germline apoptosis are normal (PubMed:23505386).
In a ced-3 n2427 mutant background, more animals have the M4 sister cell that survives (PubMed:23505386).
In a csp-3 n4872, csp-2 n4871 and ced-3 n3692 mutant background where the canonical apoptotic pathway is impaired, 16 percent of animals have still 1 or more cell corpses that are morphologically apoptotic and are internalized by engulfing cells (PubMed:23505386).
In addition, apoptosis of the male linker cell occurs normally (PubMed:23505386).
RNAi-mediated knockdown causes a 50 percent inhibition of Mn2+-induced dopaminergic CEP neuron degeneration (PubMed:23721876).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 406 | Loss of catalytic activity. Loss of autoprocessing. | ||||
Sequence: C → S |
PTM/Processing
Features
Showing features for propeptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000439218 | 1-273 | Removed in mature form by autoprocessing | |||
Sequence: MVLKTIEDNCKSQFDDDLVEDFNNFQTTSSMSSSTTISTEDFNTIEIESTFEICRSGSYTEEPILGENDEFLIDFEMERFLKFLKDKTKQVEKRKEPFSQKEIYAVFQRRIKSELCIETVKKKFQPLLPNAIQTCEFDEETMIRMIYGAGIRIDSVDFWNRFTSKATISLDCYSRLISYSSDSLTLSGTHRSGFTYHWISTPPVTYHRTENKDPNIQEPSPVEFLDVQSSLGSSMKPPILDKPTKLDDPAETRHDCSYSLEEYDSQSRMPRTD | ||||||
Chain | PRO_0000439219 | 274-418 | Caspase A subunit p16 | |||
Sequence: AKKSNHKHKYCYEMNSNPRGTVLILSNENFKNMERRVGTKQDEVNLTKLFQKLQYTVICKRNLEAESMLEAIKEFAEMAHTDSIILFLLSHGDGAGSVFGIDDMPVNVMEVSTYLAYHQNLLLKPKWVAVSACRGGKLNMGVPVD | ||||||
Chain | PRO_0000439220 | 419-536 | Caspase A subunit p14 | |||
Sequence: GLPALEDKCAPISKFWNLMMSRIMPGTFTSLNADVIISFSTTDGFTSYRDEEAGTWYIKSMCKVFNKHSKTMHLLDILTETGRNVVTKYENVQGNVVLKQAPEILSRLTKQWHFSRSM |
Post-translational modification
Autocatalytic cleavage removes the propeptide and generates the two active subunits p16 and p14 in vitro. Cannot be cleaved by ced-3 in vitro.
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Isoform a: Expression is restricted to the late germline pachytene stage of meiosis I in both L4 larvae and adult hermaphrodite gonads. Isoform b: Expression is restricted to the late germline pachytene stage of meiosis I in both L4 larvae and adult hermaphrodite gonads.
Gene expression databases
Interaction
Subunit
Heterodimer formed by the tight association of the large subunit p16 and the small subunit p14.
Protein-protein interaction databases
Structure
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 3 isoforms produced by Alternative splicing.
G5EBM1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length536
- Mass (Da)61,467
- Last updated2011-12-14 v1
- Checksum089F72490C6AA69E
G5EBM1-2
- Nameb
- Differences from canonical
- 1-268: Missing
G5EBM1-3
- Namec
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF088285 EMBL· GenBank· DDBJ | AAC98292.1 EMBL· GenBank· DDBJ | mRNA | ||
AF088286 EMBL· GenBank· DDBJ | AAC98293.1 EMBL· GenBank· DDBJ | mRNA | ||
AF088287 EMBL· GenBank· DDBJ | AAC98294.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284602 EMBL· GenBank· DDBJ | CAB07698.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284602 EMBL· GenBank· DDBJ | CAD18879.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BX284602 EMBL· GenBank· DDBJ | CAD18880.1 EMBL· GenBank· DDBJ | Genomic DNA |