G5E8A8 · TEKT5_MOUSE
- ProteinTektin-5
- GeneTekt5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids557 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Sperm-specific microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in flagellar axoneme (PubMed:20378928, PubMed:37295417, PubMed:37865089, PubMed:37989994).
Forms an extensive interaction network in different conformations that reinforces the helix bundle composed by other tektin proteins (TEKT1 to TEKT4) and MIPs to anchor the tektin bundle onto the tubulin wall of A-tubule of the sperm flagellum (PubMed:37295417, PubMed:37865089).
Forms an extensive interaction network in different conformations that reinforces the helix bundle composed by other tektin proteins (TEKT1 to TEKT4) and MIPs to anchor the tektin bundle onto the tubulin wall of A-tubule of the sperm flagellum (PubMed:37295417, PubMed:37865089).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axonemal A tubule inner sheath | |
Cellular Component | microtubule cytoskeleton | |
Cellular Component | sperm flagellum | |
Biological Process | cilium assembly | |
Biological Process | cilium movement involved in cell motility | |
Biological Process | flagellated sperm motility |
Names & Taxonomy
Protein names
- Recommended nameTektin-5
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionG5E8A8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Male mice are fertile but show lower fraction of motile sperm cells due to a significant proportion of cells with deformed flagella.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 22 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000436475 | 1-557 | Tektin-5 | |||
Sequence: MEFLGTTQTASFCGPKKGCGLQALPPAGQEPVVQECYQPFHLPGYRYLNAWRPSVFHKIATSQTIPEECSGIRRPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSFPSTPRLTGYTCSAIGSGPYANHAPRISSGPCSGSALCKGPASCGGGASCGGGASCGGHAPCGSALCSHSVSRSGPGFAPVC |
Post-translational modification
Ubiquitinated, leading to its degradation. Deubiquitinated by USP16, promoting its stability.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Strongly expressed in germ cells of the testis (at protein level) (PubMed:20378928).
Expressed in spermatozoa (PubMed:36708031).
Also detected in brain (PubMed:20378928).
Expressed in spermatozoa (PubMed:36708031).
Also detected in brain (PubMed:20378928).
Developmental stage
In germ cells, has highest expression levels during late spermiogenesis (in round spermatids and condensing spermatids).
Gene expression databases
Structure
Family & Domains
Features
Showing features for coiled coil, repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 302-386 | |||||
Sequence: DNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKE | ||||||
Repeat | 507-512 | 1 | ||||
Sequence: CSGSAL | ||||||
Region | 507-541 | 6 X 6 AA approximate tandem repeats of C-[GSK]-G-[GSPH]-A-[SLP] | ||||
Sequence: CSGSALCKGPASCGGGASCGGGASCGGHAPCGSAL | ||||||
Repeat | 513-518 | 2 | ||||
Sequence: CKGPAS | ||||||
Repeat | 519-524 | 3 | ||||
Sequence: CGGGAS | ||||||
Repeat | 525-530 | 4 | ||||
Sequence: CGGGAS | ||||||
Repeat | 531-536 | 5 | ||||
Sequence: CGGHAP | ||||||
Repeat | 537-541 | 6 | ||||
Sequence: CGSAL |
Sequence similarities
Belongs to the tektin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
G5E8A8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length557
- Mass (Da)62,734
- Last updated2011-12-14 v1
- Checksum90AB6782207FB7B6
G5E8A8-2
- Name2
- Differences from canonical
- 416-557: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_058377 | 416-557 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
GQ292766 EMBL· GenBank· DDBJ | ADD80740.1 EMBL· GenBank· DDBJ | mRNA | ||
AC154311 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466521 EMBL· GenBank· DDBJ | EDK97311.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC115969 EMBL· GenBank· DDBJ | AAI15970.1 EMBL· GenBank· DDBJ | mRNA |