G4N0X4 · CHS6_PYRO7
- ProteinChitin synthase 6
- GeneCHS6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1872 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Polymerizes chitin, a structural polymer of the cell wall and septum, by transferring the sugar moiety of UDP-GlcNAc to the non-reducing end of the growing chitin polymer (Probable). Required for appressorium penetration and invasive growth (PubMed:22346755).
Catalytic activity
- [(1->4)-N-acetyl-beta-D-glucosaminyl](n) + UDP-N-acetyl-alpha-D-glucosamine = [(1->4)-N-acetyl-beta-D-glucosaminyl](n+1) + H+ + UDPThis reaction proceeds in the forward direction.
[(1→4)-N-acetyl-β-D-glucosaminyl](n) RHEA-COMP:9593 + CHEBI:57705 = [(1→4)-N-acetyl-β-D-glucosaminyl](n+1) RHEA-COMP:9595 + CHEBI:15378 + CHEBI:58223
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | myosin complex | |
Molecular Function | actin binding | |
Molecular Function | ATP binding | |
Molecular Function | chitin synthase activity | |
Molecular Function | cytoskeletal motor activity | |
Biological Process | conidium formation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameChitin synthase 6
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Sordariomycetes > Sordariomycetidae > Magnaporthales > Pyriculariaceae > Pyricularia
Accessions
- Primary accessionG4N0X4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 881-901 | Helical | ||||
Sequence: WVFITWMLTFFVPEFLIQHLG | ||||||
Transmembrane | 920-940 | Helical | ||||
Sequence: FIIWFSCLAAAFILVVFPMLV | ||||||
Transmembrane | 1193-1213 | Helical | ||||
Sequence: FILAVTIILCSIIAFKFLAAL | ||||||
Transmembrane | 1581-1601 | Helical | ||||
Sequence: FIVFIDLLSTIIQPVTIAYIV | ||||||
Transmembrane | 1614-1634 | Helical | ||||
Sequence: VPVLAFVLLAAVYGLQAIIFI | ||||||
Transmembrane | 1641-1661 | Helical | ||||
Sequence: MIAWMILYIIAMPIFSFGLPL |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Results in a 31% reduction in vegetative growth (PubMed:22346755).
Forms colonies with short, compact aerial hyphae and wrinkled surface (PubMed:22346755).
Reduces conidiation over 5-fold (PubMed:22346755).
Leads to increased susceptibility to osmotic and cell wall stresses (PubMed:22346755).
Does not significantly changes in the chitin content in vegetative hyphae, but reduces the chitin content by approximately 40% in conidia (PubMed:22346755).
Blocks appressorium penetration and invasive growth (PubMed:22346755).
Forms colonies with short, compact aerial hyphae and wrinkled surface (PubMed:22346755).
Reduces conidiation over 5-fold (PubMed:22346755).
Leads to increased susceptibility to osmotic and cell wall stresses (PubMed:22346755).
Does not significantly changes in the chitin content in vegetative hyphae, but reduces the chitin content by approximately 40% in conidia (PubMed:22346755).
Blocks appressorium penetration and invasive growth (PubMed:22346755).
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000460880 | 1-1872 | Chitin synthase 6 | |||
Sequence: MAQHLPPVGGNGGAHTQPSLPALPAHLQSDTHLTGHLASRFHVSLPTAKLSSHAFISINTYTSSSKGQDGGKAGSAQGEAEDMADRAFLRLGHRSENQAILFLGESGSGKTTIRSHILTALLNKTSTPLSTKVSLAAYVFDTLTTTKTATTPTASKAGLFYELQYDTASTTSPLLIGGKLLDHRLERSRITDVPTGERNFHILYYILAGTSAAEKTHLGFGEPDAGTGSKRWRYLGHPTQLKVGINDAQGFQLFKTALRKLEFPRSEIAEICQVLASILHIGQLEFESSENTTVAGDESGGFSHEGGQITTVAKNKDVLAIVAAFLGVSAAELQTTLGYKTKIIHKERVTVMLDPAGARANANELARTLYSLLVAYVIENINQKICAPEEAIVNTVSIIDFPGFSQQSSTGSSLDLLLNNAAAEAMYNLTLQNFFDRKADLLETEEVSVPPTSYFDNSDAVKGLLKTGNGLLSILDDQTRRHRTDMQLLESLRKRFEGKNPAIGVSAATAKLPGSNFLSENTAASFTVRHFAGEVEYSIKGLVEENGEVISGDLLNLVNSTKSDFIARLFGQEALHTVTHPQERTTVMQASVSSKPMRAPSVMSRKIRPGTARTTRQRKESISGRQDTLDDIASEAGDSRRPVNKPSEEGASGQFLHSLDNVTKSFHAQNTNAYFVFCLKPNDRRIANQFDSKCVRTQMQTFGIAEISQRIRSADFSVFLPFGEFLGLADVDTLLVGSEREKVEAVVDEKRWPTNEIQIGSTGVFISERCWMEIAQLSDMVTGRFGVPESEGGTPLANMPYGASKERLIAAGNSPYNNDKAKSGYFGSNDIDGRSDAGVSAFGGGDMFKNLDTREQMAERGNEKSMVEVEEFKDSPSRKRWVFITWMLTFFVPEFLIQHLGKMPRKDVRMAWREKLAINFIIWFSCLAAAFILVVFPMLVCPTQYVFTGEELSAYNGKDGKASYAAIRGQVFDIGSFIPRHPLPYLPSKLFTQYAGTDITGLFPVQVSALCQGTTGSVNPAVLLDYKDTNITDSPNVFNSQDLNSRYHDFRYFTNDTRPDWFSQMMITFRGTYKKGNIGYPAQVVQKMAQQRNAIAILNGRVYDFTKYIAGGRDFRVKYNETRPTDQSLLDFMDPSVVRLFSDRSGEDVTPLWDALRLDPTLRKSMQLCLDNLFYLGDVDTRNSVRCNFAKYFILAVTIILCSIIAFKFLAALQFGTKNMPENLDKFIMCQIPAYTEDEESLRRAIDSAARMRYDDKRKLLIVVCDGMIIGQGNDRPTPRIVLDILGVSETVDPEPLSFESLGEGLKQHNMGKVYSGLYEVQGHIVPFLVVVKVGKPSEVSRPGNRGKRDSQMVIMRFLNRVHYNLAMSPLELEMYHQIRNIIGVNPTFYEYMLQIDADTVVAADSATRFVSAFLDDTRLIACCGETSIANAKSSFITMIQVYEYYISHNLSKAFESLFGSVTCLPGCFSMYRIRAAETGKPLFVSREVVDAYATIRVDTLHMKNLLHLGEDRYLTTLLLKYHNKYKTKYIYRAHAWTIAPDSWKVFLSQRRRWINSTVHNLIELIPMGQLCGFCCFSMRFIVFIDLLSTIIQPVTIAYIVYLIVRMVLTPDLVPVLAFVLLAAVYGLQAIIFILRRKWEMIAWMILYIIAMPIFSFGLPLYAFWHMDDFTWGNTRVVTGEKGKKVVVTDEGKFDPSSIPRKKWEEYQSELWDAQTSKDDTRSEASGFSYATKAPVAVSEYGFPVNPYGAYPPSRPGSTTGIPHMPHMPYSASRMSLAHSEMLMAGNRQSQFGGSQFNLPQSGSEMELSNLAGLPSDDALLAEIREILRTADLMTVTKKGVKQELERRFGVNLDSRRAYINSATEALLSGQL | ||||||
Glycosylation | 123 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 291 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 428 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 559 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 661 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1030 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1055 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1120 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1450 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1556 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Expression
Induction
Expression is induced in vegetative hyphae and infected rice leaves.
Interaction
Protein-protein interaction databases
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-779 | Myosin motor | ||||
Sequence: MAQHLPPVGGNGGAHTQPSLPALPAHLQSDTHLTGHLASRFHVSLPTAKLSSHAFISINTYTSSSKGQDGGKAGSAQGEAEDMADRAFLRLGHRSENQAILFLGESGSGKTTIRSHILTALLNKTSTPLSTKVSLAAYVFDTLTTTKTATTPTASKAGLFYELQYDTASTTSPLLIGGKLLDHRLERSRITDVPTGERNFHILYYILAGTSAAEKTHLGFGEPDAGTGSKRWRYLGHPTQLKVGINDAQGFQLFKTALRKLEFPRSEIAEICQVLASILHIGQLEFESSENTTVAGDESGGFSHEGGQITTVAKNKDVLAIVAAFLGVSAAELQTTLGYKTKIIHKERVTVMLDPAGARANANELARTLYSLLVAYVIENINQKICAPEEAIVNTVSIIDFPGFSQQSSTGSSLDLLLNNAAAEAMYNLTLQNFFDRKADLLETEEVSVPPTSYFDNSDAVKGLLKTGNGLLSILDDQTRRHRTDMQLLESLRKRFEGKNPAIGVSAATAKLPGSNFLSENTAASFTVRHFAGEVEYSIKGLVEENGEVISGDLLNLVNSTKSDFIARLFGQEALHTVTHPQERTTVMQASVSSKPMRAPSVMSRKIRPGTARTTRQRKESISGRQDTLDDIASEAGDSRRPVNKPSEEGASGQFLHSLDNVTKSFHAQNTNAYFVFCLKPNDRRIANQFDSKCVRTQMQTFGIAEISQRIRSADFSVFLPFGEFLGLADVDTLLVGSEREKVEAVVDEKRWPTNEIQIGSTGVFISERCWMEIAQLSD | ||||||
Region | 659-683 | Actin-binding | ||||
Sequence: LDNVTKSFHAQNTNAYFVFCLKPND | ||||||
Domain | 944-1003 | Cytochrome b5 heme-binding | ||||
Sequence: QYVFTGEELSAYNGKDGKASYAAIRGQVFDIGSFIPRHPLPYLPSKLFTQYAGTDITGLF | ||||||
Domain | 1814-1869 | DEK-C | ||||
Sequence: LPSDDALLAEIREILRTADLMTVTKKGVKQELERRFGVNLDSRRAYINSATEALLS |
Sequence similarities
Belongs to the chitin synthase family. Class V subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,872
- Mass (Da)208,191
- Last updated2011-12-14 v1
- Checksum102686700131DDCD
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CM001233 EMBL· GenBank· DDBJ | EHA52352.1 EMBL· GenBank· DDBJ | Genomic DNA |